DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and Aen

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001347638.1 Gene:Aen / 68048 MGIID:1915298 Length:336 Species:Mus musculus


Alignment Length:239 Identity:70/239 - (29%)
Similarity:102/239 - (42%) Gaps:56/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1028 EMPQSGDL--VAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYI 1090
            |.|:.|.:  ||:|.|.|...|:       |:.:.:..|  ||...|         |....|.||
Mouse   100 EAPRPGPIKCVAIDCEMVGTGPQ-------GRVSELARC--SVVSYS---------GDVLYDKYI 146

  Fly  1091 STQEKVVDYLTQFSGIKPGDLDANF-----SKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFR 1150
            ..:..:|||.|::|||....:....     .|:.|..||            |.:.|||.|.|||:
Mouse   147 RPEMPIVDYRTRWSGITRQHMHKAIPFQVAQKEILKLLK------------GKVVVGHALHNDFQ 199

  Fly  1151 VINIYVPSEQIIDTVH---LFHMPH---HRMVSLRFLAWHFLGTKIQ--SETHDSIEDARTTLQL 1207
            .:....|..|..||.:   |...|.   ...|||:.||.:.|..|||  .:.|.|:|||.|.::|
Mouse   200 ALKYVHPRSQTRDTTYVPNLLSQPSSLIRTRVSLKDLALNLLHKKIQVGHQGHSSVEDAMTAMEL 264

  Fly  1208 YKHYLKLQEEKKFANALKNLYE-RGKQLQWKV---------PED 1241
            |: .:::|.|::.|::.:...| ||......|         |||
Mouse   265 YQ-LVEVQWEQQVASSAQAPAEDRGPDSSTDVEQYMDDQYWPED 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 56/185 (30%)
AenNP_001347638.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
Nucleolar localization signal. /evidence=ECO:0000250 25..33
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..102 1/1 (100%)
DnaQ_like_exo 110..266 CDD:324557 56/185 (30%)
Nuclear localization signal. /evidence=ECO:0000250 164..187 4/34 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..336 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.