DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and REXO4

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_065118.2 Gene:REXO4 / 57109 HGNCID:12820 Length:422 Species:Homo sapiens


Alignment Length:441 Identity:98/441 - (22%)
Similarity:156/441 - (35%) Gaps:144/441 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   819 KSPSHTSQPNAVNNSPNG----------------RQKSWFP----LTFTMGINDQGEVQVQTQSD 863
            |.|:  |.|.||...|..                :|||..|    :...||...:.::..|.:.:
Human    47 KKPA--SGPGAVVRPPKAPEDFSQNWKALQEWLLKQKSQAPEKPLVISQMGSKKKPKIIQQNKKE 109

  Fly   864 AS---------SGK------------SEQEEETEKPPTK--GLDNNRMYALHAVVCQVDDGTQKN 905
            .|         :||            |:.:.....|.||  |.::|:            .||::.
Human   110 TSPQVKGEEMPAGKDQEASRGSVPSGSKMDRRAPVPRTKASGTEHNK------------KGTKER 162

  Fly   906 LVSLINVQRP--YHTMKLAESADDPQSQWYIFNDFSISPVSP-QESVWFTLDWKVPCILFYRHVE 967
            ....|..:|.  .|..:.|:.|               :|..| :|.:||                
Human   163 TNGDIVPERGDIEHKKRKAKEA---------------APAPPTEEDIWF---------------- 196

  Fly   968 DDSESASTTSSTVTESEETIPSESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMPQS 1032
            ||.:.|..              |::.|       |...:|....||......:|..::.......
Human   197 DDVDPADI--------------EAAIG-------PEAAKIARKQLGQSEGSVSLSLVKEQAFGGL 240

  Fly  1033 GDLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVV 1097
            ...:|:|.|.|.:.|:..|              ...||:|.:...|..    ..|.|:...|.|.
Human   241 TRALALDCEMVGVGPKGEE--------------SMAARVSIVNQYGKC----VYDKYVKPTEPVT 287

  Fly  1098 DYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQII 1162
            ||.|..|||:|.:|      |:...|:...:::..::. |.|.|||.|.||.:|:.:..|.::|.
Human   288 DYRTAVSGIRPENL------KQGEELEVVQKEVAEMLK-GRILVGHALHNDLKVLFLDHPKKKIR 345

  Fly  1163 DTVHLFHMPHHRMV-----SLRFLAWHFLGTKIQSETHDSIEDARTTLQLY 1208
            ||..  :.|....|     |||.|:...||.::|...|.||:||:..::||
Human   346 DTQK--YKPFKSQVKSGRPSLRLLSEKILGLQVQQAEHCSIQDAQAAMRLY 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 30/165 (18%)
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 53/178 (30%)
REXO4NP_065118.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..194 33/175 (19%)
REX4_like 244..394 CDD:99847 51/176 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.