DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and Aen

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001101957.1 Gene:Aen / 361594 RGDID:1305051 Length:332 Species:Rattus norvegicus


Alignment Length:239 Identity:72/239 - (30%)
Similarity:101/239 - (42%) Gaps:56/239 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1028 EMPQSG--DLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYI 1090
            |.|.||  ..||:|.|.|...|:       |:.:.:..|  ||...|         |....|.||
  Rat    96 EAPSSGPSKYVAIDCEMVGTGPQ-------GRVSELARC--SVVSYS---------GDVLYDKYI 142

  Fly  1091 STQEKVVDYLTQFSGIKPGDLDANF-----SKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFR 1150
            ..:..:|||.|::|||....:....     .|:.|..||            |.:.|||.|.|||:
  Rat   143 RPEMPIVDYRTRWSGITRQHMHKAIPFQVAQKEILKLLK------------GKVVVGHALHNDFQ 195

  Fly  1151 VINIYVPSEQIIDTVH---LFHMPH---HRMVSLRFLAWHFLGTKIQ--SETHDSIEDARTTLQL 1207
            .:....|..||.||.:   |...|.   ...|||:.||.:.|..|||  ...|.|:|||.|.::|
  Rat   196 ALKYVHPGSQIRDTTYVPNLLSQPSSLTRARVSLKDLALNLLHKKIQVGHHGHSSVEDAMTAMEL 260

  Fly  1208 YKHYLKLQEEKKFANALK-NLYERGKQLQWKV---------PED 1241
            |: .:::|.|::.|:..| :..:||......|         |||
  Rat   261 YQ-LVEVQWEQQVASTAKAHPEDRGPDSSTDVEQYMDDQYWPED 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 57/185 (31%)
AenNP_001101957.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102 3/5 (60%)
Nucleolar localization signal. /evidence=ECO:0000250|UniProtKB:Q8WTP8 21..29
DnaQ 102..>263 CDD:223916 58/191 (30%)
DnaQ_like_exo 106..262 CDD:299142 57/185 (31%)
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q8WTP8 160..183 4/34 (12%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..332 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.