DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and CG3165

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001285571.1 Gene:CG3165 / 33503 FlyBaseID:FBgn0031484 Length:351 Species:Drosophila melanogaster


Alignment Length:197 Identity:37/197 - (18%)
Similarity:63/197 - (31%) Gaps:77/197 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   701 LACNLSYPNHIKDSDQYFNFG------TILKRSLSSEKSIQAFC---------ERCKKFSPTNQS 750
            :|.|.:...|.::..:...|.      |.|....::..||...|         ::.||....::.
  Fly     1 MAPNDAVAEHAEEQPKISTFAVLDLETTNLPAYRNNRVSITELCIYAFEAALLKKKKKEQDQDEQ 65

  Fly   751 VKVTSLPQIL-SIN----------------CGLNN---EKD-----------ITFLKRQ------ 778
            .::.:.|::| .:|                .||:|   |::           ::|||..      
  Fly    66 QELPAAPRVLHKLNVLFQPSMVVDPEAERITGLSNYLLERESQLDTDAAQLIVSFLKHLPSPVCL 130

  Fly   779 ------------LNRCSEKTTVDAAASLSTSKPCRYGANCSRSDCHFMHPDRKSPSHTSQ---PN 828
                        |.:..||..::...||:          |..|...||..|......|||   ||
  Fly   131 VAHNGWGFDFPILRQAFEKLNIELPQSLT----------CVDSLRAFMEIDDTQQKETSQLKVPN 185

  Fly   829 AV 830
            .|
  Fly   186 DV 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 37/197 (19%)
zf-CCCH_2 799..816 CDD:317060 4/16 (25%)
PAN2_exo 1036..1209 CDD:99846
CG3165NP_001285571.1 DnaQ 19..>155 CDD:223916 21/135 (16%)
TREX1_2 20..173 CDD:99839 28/162 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.