DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and Rexo4

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_001029056.1 Gene:Rexo4 / 311826 RGDID:1306220 Length:409 Species:Rattus norvegicus


Alignment Length:490 Identity:100/490 - (20%)
Similarity:166/490 - (33%) Gaps:183/490 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   732 KSIQAFCERCKKFSPTNQSVKVTSLPQILSINCGLNNEKDITFLKRQLNRCSEKTTVDAAASLST 796
            |::|...:| |..:|..        |:|..::..::::    .:::...:.|:|:..|...  ..
  Rat    62 KALQELLKR-KSEAPEK--------PRISQLDDKIHHQ----IIQKNRKKTSDKSKGDKRT--ED 111

  Fly   797 SKPCRYGANCSRSDCHFMHPDRKSPSHTSQPNAVNNSPNGRQKSWFPLTFTMGINDQGEVQVQTQ 861
            .||.|                   .|.||.|..|..:|       .|.|...|...:...:.:|:
  Rat   112 DKPTR-------------------DSVTSAPKKVRKTP-------VPPTNASGTEQKKGAEKRTR 150

  Fly   862 SDASSGKSEQEEETEKPPTKGLDNNRMYALHAVVCQVDDGTQKNLVSLINVQRPYHTMKLAESAD 926
            ||.||.:.:.:.:                          |..|....:::               
  Rat   151 SDLSSHQGDIKHK--------------------------GKAKEAAVILS--------------- 174

  Fly   927 DPQSQWYIFNDFSISPVSPQESVWF-TLDWKVPCILFYRHVEDDSESASTTSSTVTESEETIPSE 990
                          .|...:|.:|| .:|            .||.|:|                 
  Rat   175 --------------QPTPTEEDIWFDDVD------------PDDIEAA----------------- 196

  Fly   991 SSSGSPTNLSNPFLEEIVSPMLGNLSADATLQPLQSDEMPQSGDL---VAMDAEFVTLNPEENEI 1052
                     ..|....:|...||..::..:|...|:     .|.|   :|:|.|.|.:.|:..| 
  Rat   197 ---------VGPEAAMLVRKRLGQRTSTISLVKEQA-----FGGLTKALALDCEMVGVGPKGEE- 246

  Fly  1053 RPDGKTATIKPCHMSVARISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDL----DA 1113
                         ...||:|.:...|..    ..|.|:...|.|.||.|..|||:|.:|    :.
  Rat   247 -------------SIAARVSIVNQYGKC----VYDKYVKPTEPVTDYRTAVSGIRPENLKQGEEF 294

  Fly  1114 NFSKKRLTALKYSYQKLKYLVDVGVIFVGHGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMV-- 1176
            ...||.:.|:      ||     |.|.|||.|:||.:|:.:..|.::|.||...  .|...:|  
  Rat   295 EVVKKEVAAM------LK-----GRILVGHALRNDLKVLFLEHPKKKIRDTQKF--KPFRSLVKS 346

  Fly  1177 ---SLRFLAWHFLGTKIQSETHDSIEDARTTLQLY 1208
               ||:.|:...||.::|...|.|::||:..::||
  Rat   347 ARPSLKQLSEKILGLRVQQAEHCSVQDAQAAMRLY 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986 29/207 (14%)
zf-CCCH_2 799..816 CDD:317060 2/16 (13%)
PAN2_exo 1036..1209 CDD:99846 54/182 (30%)
Rexo4NP_001029056.1 DnaQ 228..>392 CDD:223916 54/185 (29%)
REX4_like 231..381 CDD:99847 52/180 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.