DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and Rexo5

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:XP_038934563.1 Gene:Rexo5 / 309036 RGDID:1305412 Length:846 Species:Rattus norvegicus


Alignment Length:293 Identity:83/293 - (28%)
Similarity:114/293 - (38%) Gaps:84/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   990 ESSSGSPTNLSNPFLEEIVSPMLGNLSADATLQ------------------------PLQ----- 1025
            :|:.|.|..:..|.:...:...: :|..|..:|                        |||     
  Rat   141 KSARGCPRTVEGPLISATLKSSI-DLQNDPIIQKYGYKNVSLTRCLLTKEEMKTFHFPLQGSPNC 204

  Fly  1026 --------SDEMPQSGDLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVARISCIRGQGPAE- 1081
                    |..:..|..|..:|.| |.|.....|:                .|||.:     || 
  Rat   205 ENFILLKYSGFITDSSPLFGLDCE-VCLTSMGKEL----------------TRISLV-----AEG 247

  Fly  1082 GVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRL----TALKYSYQKLKYLVDVGVIFVG 1142
            |...||:.:....|::||||.||||         :|:.|    |.||...:.|:.|:....:.||
  Rat   248 GYCLMDELVKPDFKILDYLTSFSGI---------TKEILNPVTTKLKDVQKLLRELLPPDAVLVG 303

  Fly  1143 HGLKNDFRVINIYVPSEQIIDTVHLFHMPHHRMVSLRFLAWHFLGTKIQSET---HDSIEDARTT 1204
            |.|..|.||:.|..|  .:|||..|:.....|...|.|||...||..||...   ||.||||||.
  Rat   304 HCLDLDLRVLKIIHP--YVIDTSLLYIGKQGRRFKLTFLAKVILGKDIQCPNKLGHDGIEDARTA 366

  Fly  1205 LQLYKHYLKLQEEKKFA----NALKNLYERGKQ 1233
            |:|.:::|| ...||.|    .||....|:|.:
  Rat   367 LELVQYFLK-YGPKKIAEFNLEALAANQEQGNK 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 61/180 (34%)
Rexo5XP_038934563.1 REX1_like 223..371 CDD:99848 61/180 (34%)
RRM_SF 508..578 CDD:418427
RRM_SF 604..674 CDD:418427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.