DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and sel-10

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:NP_506421.1 Gene:sel-10 / 179878 WormBaseID:WBGene00004767 Length:587 Species:Caenorhabditis elegans


Alignment Length:127 Identity:28/127 - (22%)
Similarity:58/127 - (45%) Gaps:13/127 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 MVSMLQLSPHRLVMAGLQDELID---FDLRTLKETRIEHVGAGGCTVLRKNSRYLFAGDQLGTVT 207
            :::.:|:....|| .|..|..:.   .|...:..|.:.|.|....:.:.:..||:.:|....||.
 Worm   258 VITCMQIHDDVLV-TGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVK 321

  Fly   208 LRDLNSLSVQHTIKTHTNILSDFSVQGNLLISCGYSGRQNNLAIDRFLMVYDLRMLRLIAPI 269
            :......|:.||::.||:.:...::.|::|:    :|.:     |..|.|:|:...|.:|.:
 Worm   322 VWSTVDGSLLHTLQGHTSTVRCMAMAGSILV----TGSR-----DTTLRVWDVESGRHLATL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360 28/127 (22%)
WD40 repeat 148..183 CDD:293791 8/37 (22%)
WD40 repeat 187..221 CDD:293791 8/33 (24%)
WD40 repeat 227..273 CDD:293791 9/43 (21%)
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846
sel-10NP_506421.1 F-box-like 124..167 CDD:289689
WD40 <243..532 CDD:225201 28/127 (22%)
WD40 248..530 CDD:238121 28/127 (22%)
WD40 repeat 259..294 CDD:293791 7/35 (20%)
WD40 repeat 300..336 CDD:293791 8/35 (23%)
WD40 repeat 341..375 CDD:293791 9/43 (21%)
WD40 repeat 382..415 CDD:293791
WD40 repeat 421..460 CDD:293791
WD40 repeat 468..500 CDD:293791
WD40 495..>572 CDD:295369
WD40 repeat 506..529 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.