DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PAN2 and isg20

DIOPT Version :9

Sequence 1:NP_610427.2 Gene:PAN2 / 35893 FlyBaseID:FBgn0033352 Length:1241 Species:Drosophila melanogaster
Sequence 2:XP_003201484.2 Gene:isg20 / 100534720 ZFINID:ZDB-GENE-100422-17 Length:338 Species:Danio rerio


Alignment Length:278 Identity:76/278 - (27%)
Similarity:110/278 - (39%) Gaps:72/278 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   953 LDWKVPCILFYRHVEDDSESASTTSSTVTE------------SEETIPSESSSGSPTNLSNPFLE 1005
            ||.|..||           ...:||..|:|            :..|:|.||     ..:.:.|..
Zfish    66 LDNKTECI-----------KNGSTSDFVSEESNNMQFKRPRLTHHTLPGES-----WEVDSGFSS 114

  Fly  1006 EIVSPMLGNLSADATLQP-LQSDEMPQSGDLVAMDAEFVTLNPEENEIRPDGKTATIKPCHMSVA 1069
            |...|..|..|      | |:.|.    ..:||||.|.|...       |.|:.:       .||
Zfish   115 ESSPPTSGRSS------PCLRIDH----SRIVAMDCEMVGTG-------PGGRRS-------EVA 155

  Fly  1070 RISCIRGQGPAEGVPFMDDYISTQEKVVDYLTQFSGIKPGDLDANFSKKRLTALKYSYQKLKYLV 1134
            |.|.:...|..    ..|.||..|:.|.||.|::|||:...|      ::....:::..::..::
Zfish   156 RCSIVDYYGNV----VYDSYILPQDPVTDYRTRWSGIRSHHL------RQAVPFEHAQNEILKIL 210

  Fly  1135 DVGVIFVGHGLKNDFRVINIYVPSEQIIDTV------HLFHMPHHRMVSLRFLAWHFLGTKIQ-- 1191
            . |.|.|||.|.:|..|:.|.|....|.||.      .|:.:..:..:||:.||...|...||  
Zfish   211 K-GKIIVGHALYHDLNVLYISVQPHMIRDTCSCVLLRQLYDVNQNCNISLKKLAQKLLNRTIQVD 274

  Fly  1192 SETHDSIEDARTTLQLYK 1209
            .:.|.|:|||.:.|.|||
Zfish   275 RQGHCSVEDALSALDLYK 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PAN2NP_610427.2 WD40 63..>270 CDD:330360
WD40 repeat 148..183 CDD:293791
WD40 repeat 187..221 CDD:293791
WD40 repeat 227..273 CDD:293791
WD40 repeat 278..314 CDD:293791
UCH_1 505..940 CDD:315986
zf-CCCH_2 799..816 CDD:317060
PAN2_exo 1036..1209 CDD:99846 53/180 (29%)
isg20XP_003201484.2 ISG20 136..292 CDD:99852 53/180 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0847
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.