DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and MARS2

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_612404.1 Gene:MARS2 / 92935 HGNCID:25133 Length:593 Species:Homo sapiens


Alignment Length:104 Identity:23/104 - (22%)
Similarity:39/104 - (37%) Gaps:27/104 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   217 LVVVMCNLKPAKMRGVTSEAMVMCASTPE---KVEVLSPPAGAVPGDL----------------V 262
            |...:|  :..::||.::.|......|.|   |::..:..||..|.:|                :
Human    68 LADALC--RHRRLRGPSTAATRFSTGTDEHGLKIQQAAATAGLAPTELCDRVSEQFQQLFQEAGI 130

  Fly   263 HCEGYPRQPDAQLNPKKKIFESCAPDLKTNGELVACYKG 301
            .|..:.|..:|:.....:.|...   ||:.|.|   |||
Human   131 SCTDFIRTTEARHRVAVQHFWGV---LKSRGLL---YKG 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 12/63 (19%)
MARS2NP_612404.1 PRK11893 46..581 CDD:237012 23/104 (22%)
'HIGH' region 52..62
'KMSKS' region 347..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.