DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and MES1

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_011780.3 Gene:MES1 / 853181 SGDID:S000003496 Length:751 Species:Saccharomyces cerevisiae


Alignment Length:137 Identity:33/137 - (24%)
Similarity:48/137 - (35%) Gaps:41/137 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GQNCSKFARNKRTMADLQQIASNNE----RAEALIN-SIE------------------AEISGIQ 58
            ||...|:   :..:|.||.:..:.|    ..|.|.| :||                  |.:..:.
Yeast    74 GQTSDKY---QFALASLQNLLYHKELPQQHVEVLTNKAIENYLVELKEPLTTTDLILFANVYALN 135

  Fly    59 QQLVERQKQEL---IKENAALAKE--------VEAALAQLVQLELRNGKKQ---IPVPGARG-FC 108
            ..||..:..||   :....||||:        .:...|..:|.:|....|.   :|.|..|. ..
Yeast   136 SSLVHSKFPELPSKVHNAVALAKKHVPRDSSSFKNIGAVKIQADLTVKPKDSEILPKPNERNILI 200

  Fly   109 TSAAPVV 115
            |||.|.|
Yeast   201 TSALPYV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198
MES1NP_011780.3 MetRS-N 11..132 CDD:401537 13/60 (22%)
PLN02610 190..>750 CDD:215329 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.