DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and AT4G13780

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_193114.1 Gene:AT4G13780 / 827012 AraportID:AT4G13780 Length:797 Species:Arabidopsis thaliana


Alignment Length:284 Identity:107/284 - (37%)
Similarity:149/284 - (52%) Gaps:61/284 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QIASNNERAEALINSIEAEI------SGIQQQL--------VERQKQELI-KENAALAKEVEAAL 84
            |.:.::||.|.|:.|...:|      .|..|.|        |.|.:::.. .::...|::..|.|
plant   535 QFSLSDERGEVLLASRPWDILPPSHRIGTPQPLFKELENDEVARYREKFAGSQSDRRARDEAANL 599

  Fly    85 A-QLVQLELRNGKKQIPVPGARGFCTSAAPVVMPAEAGPATAAPAAPAPKPAKEPKEKKSKEKKP 148
            | ||.:.:|.:.|||                                           |:..|..
plant   600 ADQLNKTKLSDAKKQ-------------------------------------------KASSKGG 621

  Fly   149 AAEKPAAAPEAPVDVGRLDLRVGKIVEVGRHPDADSLYLEKIDCGEAAPRTVVSGLVKFVPLEEM 213
            ...||..|.:..:.:.|||:||||||:..:||.||:||:|:||.|....|||||||||::|||||
plant   622 GKPKPQPAADREITMARLDIRVGKIVKAEKHPKADALYVEEIDVGGGEIRTVVSGLVKYIPLEEM 686

  Fly   214 QNRLVVVMCNLKPAKMRGVTSEAMVMCASTPE--KVEVLSPPAGAVPGDLVHCEGYPRQPDAQLN 276
            |||:|.|:|||||||||.:.|:|||:.||:.:  |||::.||..|..|:.|...|:..:||..||
plant   687 QNRMVCVLCNLKPAKMRDIVSQAMVLAASSSDGSKVELVEPPKTANIGERVTFPGFEGEPDDVLN 751

  Fly   277 PKKKIFESCAPDLKTNGELVACYK 300
            ||||::|:...||.|...||||||
plant   752 PKKKVWETLLVDLNTKENLVACYK 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 60/102 (59%)
AT4G13780NP_193114.1 PLN02610 1..797 CDD:215329 107/284 (38%)
MetRS_core 18..388 CDD:173907
Anticodon_Ia_Met 397..530 CDD:153411
tRNA_bind_EMAP-II_like 634..738 CDD:239198 60/103 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 115 1.000 Domainoid score I1997
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.