DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and AT3G59980

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_191557.1 Gene:AT3G59980 / 825168 AraportID:AT3G59980 Length:273 Species:Arabidopsis thaliana


Alignment Length:214 Identity:85/214 - (39%)
Similarity:117/214 - (54%) Gaps:17/214 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PAEAGPATAAPAAPAPKPAKEPKEKKSKEKKPAAEKPAAAPEAPVDVGRLDLRVGKIVEVGRHPD 181
            |..|...||||.|.....|.|.::|...:|:....|..|        ..||::||:||:..:|.:
plant    68 PRVATFCTAAPDAGTTVSADESEKKSESQKEEENVKETA--------NLLDIKVGRIVKAWQHEE 124

  Fly   182 ADSLYLEKIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMCAS--TP 244
            |||||:|::|.|||.||.:.|||||:|||:.:|...|||:.||||..||||.|..|::.||  ..
plant   125 ADSLYVEEVDIGEAEPRIICSGLVKYVPLDLLQGASVVVLANLKPRNMRGVKSCGMLLAASDAAH 189

  Fly   245 EKVEVLSPPAGAVPGDLV------HCEGYPRQPDAQLNPKKKIFESCAPDLKTNGELVACYKGAA 303
            |.||:|.||.|:||||.|      ..|..|.........|||::|...|.|||:...|:..|...
plant   190 ENVELLVPPEGSVPGDRVWFGNEEDLEQLPEPAPPNKVQKKKMWELVQPLLKTDASGVSMLKEHL 254

  Fly   304 LHVPGKGNVVAQTLKNVNV 322
            :.. ..|.|.:::|:|.|:
plant   255 MRT-SSGLVTSKSLRNANI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 54/102 (53%)
AT3G59980NP_191557.1 tRNA_bind_EMAP-II_like 104..208 CDD:239198 55/111 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434247at2759
OrthoFinder 1 1.000 - - FOG0000771
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100893
Panther 1 1.100 - - LDO PTHR11586
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.