DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and AT2G40660

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_565938.1 Gene:AT2G40660 / 818661 AraportID:AT2G40660 Length:389 Species:Arabidopsis thaliana


Alignment Length:271 Identity:99/271 - (36%)
Similarity:142/271 - (52%) Gaps:17/271 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ALINSIEAEISGIQQQLVERQKQELIKENAALAKEVEAALAQLVQLELRNGKKQIPVP------- 102
            |:.:::.:.:.|:.....|:....:...|....||..:.|...:.::|.....::|.|       
plant   102 AVFSALHSSVLGLSDSDKEKVPHVIRWVNYIQNKEELSTLFAPIPVKLPEFSFEVPKPAIKVETN 166

  Fly   103 -----GARGFCTSAAPVVMPAEAGPATAAPAAPAPKPAKEPKEKKSKEKKPAAEKPAAAPEAPVD 162
                 .|.|......|.|.| :.|.....|..|....||| |:.|.::||||..:| |..||.:.
plant   167 SNSKKAAEGVKPVDKPDVQP-QLGTKKTEPEEPKKNAAKE-KDAKKEKKKPAEPEP-AKKEAELS 228

  Fly   163 VGRLDLRVGKIVEVGRHPDADSLYLEKIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPA 227
            |..|:::||.|.:..:||.||||.:|:||.||...|.|||||.||...|::.||||.::.|:||.
plant   229 VSLLNIQVGLIRKAWKHPSADSLLVEEIDVGEDKVRQVVSGLAKFCSPEDLTNRLVALITNVKPG 293

  Fly   228 KMRGVTSEAMVMCASTPEK--VEVLSPPAGAVPGDLVHCEGYPRQPDAQLNPKKKIFESCAPDLK 290
            |:|.|.|:.:|:|||:.:.  ||.|.|||||.||:.|...|...:|:..||||||..|...|.|.
plant   294 KLRDVMSQGLVLCASSEDHSVVEPLLPPAGAKPGERVSFSGIEGKPEDVLNPKKKQLEKITPGLY 358

  Fly   291 TNGELVACYKG 301
            |:...||.|||
plant   359 TDENGVATYKG 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 50/102 (49%)
AT2G40660NP_565938.1 GST_C_Arc1p_N_like 50..147 CDD:198337 7/44 (16%)
tRNA_bind_EMAP-II_like 227..331 CDD:239198 50/103 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1737
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1434247at2759
OrthoFinder 1 1.000 - - FOG0000771
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100893
Panther 1 1.100 - - O PTHR11586
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2386
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.