DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and mars2

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:XP_021329980.1 Gene:mars2 / 566565 ZFINID:ZDB-GENE-111201-1 Length:595 Species:Danio rerio


Alignment Length:91 Identity:25/91 - (27%)
Similarity:41/91 - (45%) Gaps:18/91 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 EAMVMCASTPEKVEVLSPPAGAVPGDLVHCEGYPRQPDAQLNPKKKIFESCAPDLKTNGELVA-C 298
            :.|.||.|     |:    |.|:.|.|..|.. |.....|:.|  :...||.|.:..:|:.|: .
Zfish   389 KVMKMCNS-----EL----ADALGGLLNRCTA-PSLNLTQVYP--RFSNSCFPAVGLSGKAVSED 441

  Fly   299 YK--GAALHVPGKGNVVAQTLKNVNV 322
            |:  .|...:||   ::.|..:|::|
Zfish   442 YRMIEAVSALPG---IIEQHFENMHV 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 8/26 (31%)
mars2XP_021329980.1 PRK12267 45..594 CDD:330948 25/91 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.