DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and TyrRS

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_648895.1 Gene:TyrRS / 39829 FlyBaseID:FBgn0027080 Length:525 Species:Drosophila melanogaster


Alignment Length:202 Identity:96/202 - (47%)
Similarity:126/202 - (62%) Gaps:9/202 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 PAPKPAKEPKEKK---SKEKKPAAEKPAAAPEAPVDVG---RLDLRVGKIVEVGRHPDADSLYLE 188
            |..|..:.|:.:|   :....||..|..|||.|..|..   |||:||||:|||.||||||:||:.
  Fly   325 PIRKAFENPELQKLSAAAYPPPAKVKAGAAPAAGADEDAPHRLDIRVGKVVEVARHPDADTLYVL 389

  Fly   189 KIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMCASTPEK--VEVLS 251
            |||..||.|||::|||||||..||:..|||.|:|||||:||||:.||.||:|.|..:.  ||.:.
  Fly   390 KIDLAEAQPRTIISGLVKFVTEEELNQRLVAVLCNLKPSKMRGILSEGMVLCTSNADHTVVEPIV 454

  Fly   252 PPAGAVPGDLVHCEGYPRQPDAQLNPKKKIFESCAPDLKTNGELVACYKGAALHVPGKGNVVAQT 316
            .||.|..|..:..||:...||.|||||||::|..:.|.|||.:.:|.:|...|..| :|..::..
  Fly   455 LPATATAGSRLSFEGFSGTPDEQLNPKKKVWEKLSADFKTNSDGLAVWKDNFLLTP-EGEKLSSK 518

  Fly   317 LKNVNVK 323
            |.|.::|
  Fly   519 LANCSIK 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 61/105 (58%)
TyrRSNP_648895.1 nt_trans 8..334 CDD:294020 2/8 (25%)
tyrS 12..332 CDD:272976 2/6 (33%)
tRNA_bind_EMAP-II_like 364..466 CDD:239198 60/101 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I431
eggNOG 1 0.900 - - E1_COG0143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D110368at33392
OrthoFinder 1 1.000 - - FOG0000771
OrthoInspector 1 1.000 - - otm51370
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11586
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.