DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and MetRS

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_611382.1 Gene:MetRS / 37177 FlyBaseID:FBgn0034401 Length:1022 Species:Drosophila melanogaster


Alignment Length:207 Identity:42/207 - (20%)
Similarity:72/207 - (34%) Gaps:70/207 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GQNCSKFARNKRTMADLQQIASNNERAEALINSIEAEISGIQQQLVERQKQELIKENAALAKEVE 81
            |:....||:.:::..|  ::......|:|..::..::||....:...:.:.:.::|..|..|  :
  Fly   788 GKPAPLFAKLEQSFID--ELKGKYGGAQATNDAAHSQISAADLEKAVQAQADKVRELKASTK--D 848

  Fly    82 AALAQLVQLELRNGKKQIPVPGARGFCTSAAPVVMPAEAGPATAAPAAPAPKPA----------- 135
            .|:.|....:|.:.|||:                  .||...||..||||..||           
  Fly   849 KAIWQPEVTKLLDLKKQL------------------EEAKKKTATAAAPAATPAPSNGSQSVQDL 895

  Fly   136 -KEPKEKKSKEKK-----------------------------------PAAE-KPAAAPEAPVDV 163
             |..:|:..|.:|                                   |||. .|||:|.|..|.
  Fly   896 EKAIQEQGDKVRKLKGSTKDKTVWQPEVNILLDLKKQLEAVQKAAKAAPAANAAPAASPAATADA 960

  Fly   164 GRLDLRVGKIVE 175
            .::.....||.:
  Fly   961 AKVKALEDKIAQ 972

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 3/15 (20%)
MetRSNP_611382.1 GstA 1..175 CDD:223698
GST_N_family 1..65 CDD:238319
GST_C_family 63..164 CDD:295467
PRK12268 254..812 CDD:237029 4/25 (16%)
MetRS_core 255..625 CDD:173907
Anticodon_Ia_Met 634..763 CDD:153411
MetRS_RNA 828..868 CDD:238475 9/59 (15%)
MetRS_RNA 895..938 CDD:238475 4/42 (10%)
MetRS_RNA 966..1009 CDD:238475 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.