DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and Y105E8A.28

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001364633.1 Gene:Y105E8A.28 / 3565614 WormBaseID:WBGene00013685 Length:225 Species:Caenorhabditis elegans


Alignment Length:220 Identity:50/220 - (22%)
Similarity:84/220 - (38%) Gaps:49/220 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGSACKNYGQNC-----SKFARNKRTMADLQQIASNNERAEALINSIEAEISG-IQQ-QLVERQK 66
            ||.|.:|...|.     .:..|.::.:...||.....|.|:...|.:|....| |:: |.:..::
 Worm    38 VGIAQQNVVANIRHLRNEELHRFRQAVPPPQQAEEAEEEADVAENVVEQNRLGPIRRGQFLGPRR 102

  Fly    67 QELIKENAALAK--EVEAALAQLVQLELRNGKKQIPVPGARGFCTSAAPVVMPAEAGPATAAPAA 129
            :.|.:.|..|.:  |....:|..:   ||:          :.|....||:     |||....|  
 Worm   103 RLLFQPNQRLCRVGEHRDGIAPNL---LRH----------QAFVPQVAPL-----AGPQPFVP-- 147

  Fly   130 PAPKPAKEP---KEKKSKEKKPAAEKPAAAPEAPVDVGRLDLRVGKI-VEVGRHPDADSLYLEKI 190
            |.|.|..||   .|:.::...|:.|:   .|..|::..|:.:.|..: |..|...:.|.      
 Worm   148 PPPPPLPEPAAAAERNAENASPSEEE---GPIGPIEPPRITMEVEPVNVTFGLTEELDD------ 203

  Fly   191 DCGEAAPRTVVSGLVKFVPLEEMQN 215
            .|..|...|.:.       :||.:|
 Worm   204 SCSTAILNTTME-------IEESRN 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 11/56 (20%)
Y105E8A.28NP_001364633.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.