DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and Yars1

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001020867.2 Gene:Yars1 / 313047 RGDID:1307616 Length:564 Species:Rattus norvegicus


Alignment Length:269 Identity:121/269 - (44%)
Similarity:156/269 - (57%) Gaps:47/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 QELIKENAA-------LAKEVEAALAQLVQLELRNGKKQIPVPGARGFCTSAAPVVMPAEAGPAT 124
            |||.|:.||       |...||.||.:|:.            |....|.|       ||....|:
  Rat   329 QELEKDFAAEVVHPGDLKNSVEVALNKLLD------------PIREKFNT-------PALKKLAS 374

  Fly   125 AAPAAPAPKPAKEPKEKKSKEKKPAAEKPAAAPEAPVDV--GRLDLRVGKIVEVGRHPDADSLYL 187
            ||    .|.|:|:         ||.|:.||.:.| |.::  .|||:|||||:.|.:||||||||:
  Rat   375 AA----YPDPSKQ---------KPTAKGPAKSSE-PEEIIPSRLDIRVGKILSVEKHPDADSLYV 425

  Fly   188 EKIDCGEAAPRTVVSGLVKFVPLEEMQNRLVVVMCNLKPAKMRGVTSEAMVMCAS---TPEKVEV 249
            ||||.|||.|||||||||:|||.||:|:|||||:|||||.|||||.|:.|::|||   ...:||.
  Rat   426 EKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVDSQGMLLCASVEGVSRQVEP 490

  Fly   250 LSPPAGAVPGDLVHCEGYPR-QPDAQLNPKKKIFESCAPDLKTNGELVACYKGAALHVPGKGNVV 313
            |.||||:.||:.|..:||.: |||.:|.||||:||....|.|.:.:.||.:|.... :...|.|.
  Rat   491 LDPPAGSAPGERVFVQGYEKGQPDEELKPKKKVFEKLQADFKISDDCVAQWKQTNF-MTKLGFVS 554

  Fly   314 AQTLKNVNV 322
            .::||..|:
  Rat   555 CKSLKGGNI 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 68/105 (65%)
Yars1NP_001020867.2 nt_trans 44..364 CDD:294020 13/46 (28%)
tyrS 45..364 CDD:272976 13/46 (28%)
tRNA_bind_EMAP-II_like 401..504 CDD:239198 68/102 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D557463at33208
OrthoFinder 1 1.000 - - FOG0000771
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.