DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and Mars1

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_001165053.1 Gene:Mars1 / 216443 MGIID:1345633 Length:910 Species:Mus musculus


Alignment Length:164 Identity:41/164 - (25%)
Similarity:58/164 - (35%) Gaps:53/164 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LRRAATTVGSACKNYGQNCSKFARNKRTMAD----------LQQIASNNERAEALINSIE----- 51
            |||..|.:..:...  |||...|.:..::||          ||..|...|...||.:..:     
Mouse   117 LRRVLTHIDHSLSR--QNCPFLAGDTESLADIVLWGALYPLLQDPAYLPEELGALQSWFQTLSTQ 179

  Fly    52 -----AEISGIQQQ-------LVERQKQ-------------ELIKENAALAKEV---------EA 82
                 |..:.::||       .:::|.|             ||.:|..|...|.         |.
Mouse   180 EPCQRAAETVLKQQGVLALRLYLQKQPQPQPPPPEGRTVSNELEEEELATLSEEDIVTAVAAWEK 244

  Fly    83 ALAQLVQLELRNGKKQIPVPGARG-FCTSAAPVV 115
            .|..|..|:|:. ...:||||.|. ..|||.|.|
Mouse   245 GLESLPPLKLQQ-HPVLPVPGERNVLITSALPYV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198
Mars1NP_001165053.1 Thioredoxin_like 1..68 CDD:294274
GstA <47..189 CDD:223698 17/73 (23%)
GST_C_MetRS_N 77..179 CDD:198340 16/63 (25%)
PRK12268 266..821 CDD:237029 6/12 (50%)
MetRS_core 267..635 CDD:173907 5/11 (45%)
'HIGH' region 275..285 2/3 (67%)
'KMSKS' region 595..599
Anticodon_Ia_Met 644..773 CDD:153411
MetRS_RNA 855..899 CDD:238475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.