DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and Mars2

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_780648.1 Gene:Mars2 / 212679 MGIID:2444136 Length:586 Species:Mus musculus


Alignment Length:30 Identity:12/30 - (40%)
Similarity:15/30 - (50%) Gaps:7/30 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLRRAA------TTVGSACKNYGQNCSKFA 24
            |||:.|      |..|..|:.|| :||..|
Mouse     1 MLRQCARWVLTRTRFGRGCRRYG-SCSPSA 29

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198
Mars2NP_780648.1 MetRS_core 37..379 CDD:173907
PRK11893 39..574 CDD:237012
'HIGH' region 45..55
'KMSKS' region 340..344
Anticodon_Ia_Met 388..532 CDD:153411
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0143
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.