powered by:
Protein Alignment AIMP1 and Mars2
DIOPT Version :9
Sequence 1: | NP_610426.2 |
Gene: | AIMP1 / 35892 |
FlyBaseID: | FBgn0033351 |
Length: | 323 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_780648.1 |
Gene: | Mars2 / 212679 |
MGIID: | 2444136 |
Length: | 586 |
Species: | Mus musculus |
Alignment Length: | 30 |
Identity: | 12/30 - (40%) |
Similarity: | 15/30 - (50%) |
Gaps: | 7/30 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MLRRAA------TTVGSACKNYGQNCSKFA 24
|||:.| |..|..|:.|| :||..|
Mouse 1 MLRQCARWVLTRTRFGRGCRRYG-SCSPSA 29
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0143 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.