DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AIMP1 and yars-1

DIOPT Version :9

Sequence 1:NP_610426.2 Gene:AIMP1 / 35892 FlyBaseID:FBgn0033351 Length:323 Species:Drosophila melanogaster
Sequence 2:NP_740947.2 Gene:yars-1 / 173311 WormBaseID:WBGene00013677 Length:722 Species:Caenorhabditis elegans


Alignment Length:359 Identity:68/359 - (18%)
Similarity:120/359 - (33%) Gaps:129/359 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EALINSIEAEI------SGIQQQL------------VERQKQELIKENAALAKEVEAALAQ--LV 88
            :||:.|::..|      .|.:.||            .:..:::.:|..|.:.|:||:.|..  |.
 Worm   113 KALLQSLDVPIEQLYFKKGTEYQLSREYTDDVLRLSAQVSQRDALKAGAEVVKQVESPLLSGLLY 177

  Fly    89 QLELRNGKKQIPVPGARGFCTSAAPVVMPAEAGP-----------------ATAAPAAPAPKPAK 136
            .|.....::.:.|.|..|........::..|..|                 .|....:.:.:.:|
 Worm   178 PLLQALDEQYLKVDGQFGGVDQRKIFILAEEQLPKLKLGKRWHLMNPMVPGLTGTKMSSSEEDSK 242

  Fly   137 -----EPKEKKSKEKKPAAEK----------------PAAAPEAPVDVGRLDLRVGKIVEVGRHP 180
                 ||::.:||....|..:                |..:|.|              :|:....
 Worm   243 IDVLDEPEKVRSKIMGAACSRDQPDNGVLSFYNFVLFPIVSPNA--------------IEIENQQ 293

  Fly   181 --DADSLYLEKIDCGEAAPRTVVSGLVKFVP--LEEMQNRLVVVMCN---LKPAKMRGVTSEAMV 238
              |.|||....:| |:....|:.:.|..|:.  ||:::     |.|:   ::.||.:|..     
 Worm   294 FFDIDSLKRAYLD-GKLDENTLKTFLADFLVNLLEKVR-----VRCDTDVVRDAKEKGYN----- 347

  Fly   239 MCASTPEKVEVLSPPAGAVPGDLVHCEGYPRQPDAQLNPKKKIFESCAPDLKTNGE--------- 294
               .:.:..|...||:.|           |:.|  .|:.::|.::    |...||.         
 Worm   348 ---HSTDSTEPAIPPSEA-----------PKIP--SLSSEQKQWK----DQLLNGNEILIGEELD 392

  Fly   295 --LVACYKGAALHV----PGKG----NVVAQTLK 318
              |........||:    ||||    ..:|..||
 Worm   393 RVLADVSPQKPLHLMFIAPGKGRFHLGFIAPLLK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AIMP1NP_610426.2 tRNA_bind_EMAP-II_like 161..262 CDD:239198 21/107 (20%)
yars-1NP_740947.2 nt_trans 21..330 CDD:294020 42/231 (18%)
trpS 45..359 CDD:272975 48/273 (18%)
nt_trans 384..705 CDD:294020 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D557463at33208
OrthoFinder 1 1.000 - - FOG0000771
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.