DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8237 and Fam8a1

DIOPT Version :9

Sequence 1:NP_610425.1 Gene:CG8237 / 35891 FlyBaseID:FBgn0033350 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001028364.1 Gene:Fam8a1 / 97863 MGIID:2145496 Length:399 Species:Mus musculus


Alignment Length:374 Identity:95/374 - (25%)
Similarity:145/374 - (38%) Gaps:113/374 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ETGQKLTERSTKEA-----------YFESLAEWAKQATLAQNAMLMFPYYLMANYPTMFPGLPSS 60
            |||.:..|....||           |...:.||..|:              ...|.|...||   
Mouse    69 ETGAEPPEAGDCEASDGPGRLSAREYSRQVHEWLWQS--------------YCGYLTWHSGL--- 116

  Fly    61 AALQA------AAMGQPQALVQGSAAAPGEPAAEPRLPAPNFS---------------------- 97
            |||.|      .|...||..|. |.::|..|::.|..|.|..:                      
Mouse   117 AALPAYCGPPPPAATAPQPAVP-SPSSPPTPSSPPPPPPPQLAYYNPFYFLSAAGPGPGAATGGA 180

  Fly    98 -----------------------GLRILGEAAQLDIIQ---RLGGYEYVLSPFWKRAVAETIDMF 136
                                   |.|: |.||......   |..|.|||:.....|.:||.:|.|
Mouse   181 TPTAVAGLTARAPHVQPSARAAPGTRV-GSAAPARTASDTGRQAGREYVIPSLAHRFMAEMVDFF 244

  Fly   137 ILFIVKIIITFGVVNLFNI----EFDEDVIRRTLDQEDLFSNFFDTSLDFISMSTDLLLIEMLTK 197
            |||.:|..|...:::|..|    :|....|...:|:        |||::.:.   .::::.::.:
Mouse   245 ILFFIKATIVLSIMHLSGIKDISKFAMHYIIEEIDE--------DTSMEDLQ---KMMIVALIYR 298

  Fly   198 FIVCCYEALWTYLYQGATPGKSLMKIRIYYVEAVMPLQGPPLPQFVLQPQREPMRALLYPPQTPS 262
            .:||.||.:..:...||||||.|:.:|:...:..:.:              .|.|.|:.|....|
Mouse   299 LLVCFYEIICIWGAGGATPGKFLLGLRVVTCDTSVLI--------------APSRVLVIPSSNVS 349

  Fly   263 LMRSFARALIKNLGMTLLFPICVLMVFFKNNRTAYDVLTKTIVVESNSI 311
            :..|..||||||..:...||..:.::||::||||||::..||||:.|.:
Mouse   350 ITTSTIRALIKNFSIASFFPAFITLLFFQHNRTAYDIVAGTIVVKRNGV 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8237NP_610425.1 RDD 123..302 CDD:294483 52/182 (29%)
Fam8a1NP_001028364.1 RDD 230..389 CDD:283845 52/183 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836966
Domainoid 1 1.000 49 1.000 Domainoid score I11768
eggNOG 1 0.900 - - E1_KOG4647
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4977
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005417
OrthoInspector 1 1.000 - - oto95363
orthoMCL 1 0.900 - - OOG6_107529
Panther 1 1.100 - - LDO PTHR13659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3819
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.