DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8237 and F48B9.8

DIOPT Version :9

Sequence 1:NP_610425.1 Gene:CG8237 / 35891 FlyBaseID:FBgn0033350 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_508402.1 Gene:F48B9.8 / 185970 WormBaseID:WBGene00018593 Length:263 Species:Caenorhabditis elegans


Alignment Length:212 Identity:50/212 - (23%)
Similarity:97/212 - (45%) Gaps:32/212 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 LDIIQ----RLGGYEYVLSPFWKRAVAETIDMFILFIVKIIITFGVVNLFNIEFDEDVIRRTLDQ 168
            ::::|    |:...::..:.|.:|.:||.||...:...|:.:...:..|.:|:..:  |..:||.
 Worm    74 VEVLQPAQPRVDSVQFEAASFLRRLLAELIDFVFILSFKLAVVGTLSELGHIDLKQ--IGASLDD 136

  Fly   169 EDLFSNFFDTSLDFISMSTDLLLIEMLTKFIVCCYEAL-----WTYLYQGATPGKSLMKIRIYYV 228
            :       ...::||:::.|||.:|::.|...|..||:     :..:..|.|.||.:..||:...
 Worm   137 D-------QDVMNFINLAQDLLPVEVVCKVFCCFVEAVLMARGFGPIGVGQTLGKWMCGIRVISC 194

  Fly   229 EAVMPLQGPPLPQFVLQPQREPMRALLYPPQTPSLMRSFARALIKNLGMTLLFPICVLMVFFKNN 293
            ..|...:.|  .|.:::           .|...:..::..|:.||||.::..||:...:......
 Worm   195 RDVTSAERP--DQIIVE-----------GPDLITYSQALKRSFIKNLVVSSFFPLSTAVFQINRG 246

  Fly   294 RTAYDVLTKT-IVVESN 309
            |..||::.|| :|||.|
 Worm   247 RVFYDMMVKTCVVVEIN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8237NP_610425.1 RDD 123..302 CDD:294483 42/183 (23%)
F48B9.8NP_508402.1 RDD 92..>234 CDD:382177 37/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159208
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4647
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I4065
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005417
OrthoInspector 1 1.000 - - oto17585
orthoMCL 1 0.900 - - OOG6_107529
Panther 1 1.100 - - LDO PTHR13659
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3819
SonicParanoid 1 1.000 - - X11771
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.