DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and AGE1

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_010812.3 Gene:AGE1 / 852136 SGDID:S000002932 Length:482 Species:Saccharomyces cerevisiae


Alignment Length:153 Identity:50/153 - (32%)
Similarity:76/153 - (49%) Gaps:25/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSNAGQR--TKLIQEKCQTL--------------LTQMLR--DEDNKYCVDCDAKGP-RWASWN 47
            |:||:..|  ||....|..|.              |..::|  |:.|..|.||.:... .|.|.|
Yeast   137 SNSNSNNRIPTKTDSSKQHTQHFSFANAGASNRDELLSIVRKIDKSNLKCCDCGSTATVEWVSIN 201

  Fly    48 LGMFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVISLQQ--MGNSRARAVYEAQLPD----GF 106
            |...|||:|:|:||:||.|||:::|:.||.:|..:::.|.|  :.||...|:||:.|.:    ..
Yeast   202 LLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMHLLQNNVSNSNVNAIYESNLRNFPVKKI 266

  Fly   107 RRPQTDTALENFIRAKYEHKKYL 129
            .....|:....||..||:.||::
Yeast   267 TANSDDSERSKFIIDKYQFKKFV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 43/135 (32%)
COG5347 20..300 CDD:227651 42/133 (32%)
AGE1NP_010812.3 COG5347 164..480 CDD:227651 42/126 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.