DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and GCS1

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_010055.1 Gene:GCS1 / 851372 SGDID:S000002385 Length:352 Species:Saccharomyces cerevisiae


Alignment Length:344 Identity:89/344 - (25%)
Similarity:134/344 - (38%) Gaps:86/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LTQMLRDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVIS 85
            |.|:.:...||.|:||.|..|:||:...|.|:|:.||||||.||||||.|:|:.:|.:.||:::.
Yeast    14 LLQLQKIGANKKCMDCGAPNPQWATPKFGAFICLECAGIHRGLGVHISFVRSITMDQFKPEELLR 78

  Fly    86 LQQMGNSRARAVYEAQLPDGFRRPQTDTALENFIRAKYEHKKYLAREWVPPSPPKVDWAKEID-- 148
            :::.||.        .|.:.|:....|.:|..  :.||:            :|...|:.:::.  
Yeast    79 MEKGGNE--------PLTEWFKSHNIDLSLPQ--KVKYD------------NPVAEDYKEKLTCL 121

  Fly   149 ---------EELERQKRKKKSTQAQATLGLAGVA----GGSGDKRLSGSSASA------------ 188
                     |.|:....|..:|...|.....|||    |...:.|.|.:.|::            
Yeast   122 CEDRVFEEREHLDFDASKLSATSQTAASATPGVAQSREGTPLENRRSATPANSSNGANFQKEKNE 186

  Fly   189 -------LKNTPLPAPLPKPKPNQVG-----GCSP-KTTQRVQLNSSGVSSAGESDLLGLSS-PT 239
                   .||...|..||   |:|.|     |.:| |..|.        .|||.|:.|.|.: ..
Yeast   187 AYFAELGKKNQSRPDHLP---PSQGGKYQGFGSTPAKPPQE--------RSAGSSNTLSLENFQA 240

  Fly   240 KPIVATNASQDLQNESFTSFLSAESIAGQPDKPIGSNGDAANLMGSKPNSLAQEEQDFFNQGSLG 304
            .|:...:....|.:.:.|.  |.|.:.....||......:..|......:.||..|.|....|.|
Yeast   241 DPLGTLSRGWGLFSSAVTK--SFEDVNETVIKPHVQQWQSGELSEETKRAAAQFGQKFQETSSYG 303

  Fly   305 ----------AGGNEKDQS 313
                      ..||.:|.|
Yeast   304 FQAFSNFTKNFNGNAEDSS 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 39/110 (35%)
COG5347 20..300 CDD:227651 83/319 (26%)
GCS1NP_010055.1 COG5347 4..350 CDD:227651 89/344 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.