DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and AGD15

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001327025.1 Gene:AGD15 / 821033 AraportID:AT3G17660 Length:246 Species:Arabidopsis thaliana


Alignment Length:218 Identity:76/218 - (34%)
Similarity:111/218 - (50%) Gaps:42/218 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TKLIQEKCQTLLTQMLRDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVN 74
            :|.:..|...:|..:|:..||:.|.||.:|.|||||.|||:|:|::|:||||:||||||:|:|:.
plant     8 SKELNAKHSKILEALLKHPDNRECADCRSKAPRWASVNLGIFICMQCSGIHRSLGVHISQVRSIT 72

  Fly    75 LDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTALENFIRAKYEHKKYLAREWVPPSP- 138
            ||||.|:||..::..||::....:|::||..|.|..:||    ||||||..|::::...:.|:| 
plant    73 LDTWLPDQVAFMKSTGNAKGNEYWESELPQHFERSSSDT----FIRAKYSEKRWVSPGAIQPAPI 133

  Fly   139 --------------------PKVDWAKEIDEELERQKRKKKSTQAQATLGLAGVAGGSGDKRLSG 183
                                ||......:|||:....      ..|.|........||.|     
plant   134 VSQLSCKVSHLVESGYKPETPKKARTLSLDEEILLHH------VLQVTPPETRTRAGSVD----- 187

  Fly   184 SSASALKNTPLPAPLPK-PKPNQ 205
                 :|......|||: .||||
plant   188 -----MKENVYVVPLPEFKKPNQ 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 54/113 (48%)
COG5347 20..300 CDD:227651 74/208 (36%)
AGD15NP_001327025.1 ArfGap 19..117 CDD:350058 51/101 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 137 1.000 Domainoid score I1586
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097163at2759
OrthoFinder 1 1.000 - - FOG0001773
OrthoInspector 1 1.000 - - otm3266
orthoMCL 1 0.900 - - OOG6_100831
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.680

Return to query results.
Submit another query.