DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and Adap2

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_038942641.1 Gene:Adap2 / 56826 RGDID:708487 Length:400 Species:Rattus norvegicus


Alignment Length:178 Identity:58/178 - (32%)
Similarity:87/178 - (48%) Gaps:39/178 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QEKCQTLLTQMLR--DEDNKYCVDCDAKGPR------------------------WASWNLGMFL 52
            :|:.:..|.::|:  ...|.:|.||.|.||.                        |||:.||:|:
  Rat     4 RERNKKRLLELLQAAGTGNGHCADCGAAGPACPCTLVQSLSSSAEILLFHPADPDWASYKLGVFI 68

  Fly    53 CIRCAGIHRNLGVHISRVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTAL-- 115
            |:.|:|:|||. ..||:||||.||.|....|..:...||...:|.:||::|..:..||....|  
  Rat    69 CLHCSGVHRNF-PDISKVKSVRLDFWDDSMVEFMTHNGNLSVKAKFEARVPTFYYVPQASDCLVL 132

  Fly   116 -ENFIRAKYEHKKYLAREWVPPSPPKVDWAKEIDEELERQKRKKKSTQ 162
             |.:||||||.::::|.:.|  |||.       |.|....||.:.::|
  Rat   133 KEQWIRAKYERQEFMAEKAV--SPPG-------DREGFLWKRGRDNSQ 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 48/142 (34%)
COG5347 20..300 CDD:227651 57/172 (33%)
Adap2XP_038942641.1 ArfGap 4..141 CDD:355783 45/137 (33%)
PH1_ADAP 156..264 CDD:270072 5/23 (22%)
PH2_ADAP 278..385 CDD:241282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.