DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8243 and agap2

DIOPT Version :9

Sequence 1:	NP_610424.1	Gene:	CG8243 / 35890	FlyBaseID:	FBgn0033349	Length:	517	Species:	Drosophila melanogaster
Sequence 2:	XP_009295321.1	Gene:	agap2 / 565109	ZFINID:	ZDB-GENE-061103-343	Length:	1130	Species:	Danio rerio

Alignment Length:	144	Identity:	55/144 - (38%)
Similarity:	76/144 - (52%)	Gaps:	22/144 - (15%)

- Green bases have known domain annotations that are detailed below.

  Fly     3 SSNAGQRTKLIQEKCQTLLTQMLRD-EDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVH 66
            |.|..:|    ..:.:.:..|.:|: :.|..||||.|..|.|||.|||..:||.|:|||||||.|
Zfish   865 SRNKARR----NSQSEAVALQAIRNAKGNDLCVDCAAPNPTWASLNLGALICIECSGIHRNLGTH 925

  Fly    67 ISRVKSVNLDTWTPEQVISLQQMGNSRARAVYEA-------QLPDGFRRPQTDTALENFIRAKYE 124
            :|||:|::||.|..|....|..:||..|..::|.       ..|:..|..:     |::||||||
Zfish   926 LSRVRSLDLDVWPSELTKVLSAIGNHMANHIWETCTQGCQKLTPEATREQR-----ESWIRAKYE 985

  Fly   125 HKKYLAREWVPPSP 138
            .     |.:|.|.|
Zfish   986 Q-----RAFVSPLP 994

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8243	NP_610424.1	ArfGap	18..132	CDD:279720	48/121 (40%)
CG8243	NP_610424.1	COG5347	20..300	CDD:227651	52/127 (41%)
agap2	XP_009295321.1	Centaurin_gamma	355..512	CDD:133303
		Ras	359..512	CDD:278499
		PH-like	616..861	CDD:302622
		ArfGap	879..993	CDD:279720	50/123 (41%)
		ANK repeat	1040..1071	CDD:293786
		Ank_4	1041..1094	CDD:290365
		ANK	1042..>1098	CDD:238125
		ANK repeat	1073..1098	CDD:293786
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910