DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and APPL2

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001238833.1 Gene:APPL2 / 55198 HGNCID:18242 Length:670 Species:Homo sapiens


Alignment Length:353 Identity:67/353 - (18%)
Similarity:115/353 - (32%) Gaps:103/353 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKCQTLLTQMLRDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNL---- 75
            ||.:....::|..:::.|..|.|...|:                |:|||   |.:...:||    
Human   251 EKMRVSQQELLSVDESVYTPDSDVAAPQ----------------INRNL---IQKAGYLNLRNKT 296

  Fly    76 ----DTWTPEQVISLQQMGNSRAR---AVYEAQLPDGFRRPQTDTALEN--FIRAKYEHKKYLAR 131
                .||  |::....|.||...:   ||....:.|          |:|  .:....|.::|..:
Human   297 GLVTTTW--ERLYFFTQGGNLMCQPRGAVAGGLIQD----------LDNCSVMAVDCEDRRYCFQ 349

  Fly   132 EWVPPSPPKV-----------DWAKEIDEELERQ----------KRKKKSTQAQATLGLAGVAGG 175
            ...|.....:           :|...|: .:.||          ..|...|..||...:...   
Human   350 ITTPNGKSGIILQAESRKENEEWICAIN-NISRQIYLTDNPEAVAIKLNQTALQAVTPITSF--- 410

  Fly   176 SGDKRLSGSSASALKNTPLPAPLPKPKPNQVGGCSPKTTQRVQLNSSGVSSAGESDLLGLSSPTK 240
             |.|:.|...:..|||:.:        .|:.....||.|         .|.....:|:...:|.:
Human   411 -GKKQESSCPSQNLKNSEM--------ENENDKIVPKAT---------ASLPEAEELIAPGTPIQ 457

  Fly   241 PIVATNASQDLQNESFTSFLSAESIAGQPDKPIGSNGDAANLMGSKPNSLAQEEQDFFNQGSLGA 305
            ..:...|         |.||. ::...:...|.|...|.     |.|.:.....|..|....||:
Human   458 FDIVLPA---------TEFLD-QNRGSRRTNPFGETEDE-----SFPEAEDSLLQQMFIVRFLGS 507

  Fly   306 GGNEKDQSGKMSKDSILALYGSAPATHN 333
            ...:.|.:.::..:::..:. :|.|.||
Human   508 MAVKTDSTTEVIYEAMRQVL-AARAIHN 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 25/126 (20%)
COG5347 20..300 CDD:227651 58/313 (19%)
APPL2NP_001238833.1 BAR_APPL2 20..240 CDD:153316
BAR-PH_APPL 258..382 CDD:270067 28/155 (18%)
PTB_APPL 488..621 CDD:269980 10/48 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 649..670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.