DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and CenB1A

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_524458.1 Gene:CenB1A / 42735 FlyBaseID:FBgn0039056 Length:828 Species:Drosophila melanogaster


Alignment Length:395 Identity:105/395 - (26%)
Similarity:163/395 - (41%) Gaps:76/395 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QMLRDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVISLQ 87
            :.|:...|.||.||.:..|||||.|||:.|||.|:|:||:||||.|:|:|:.||.|..|.|..:.
  Fly   386 EFLKIPGNAYCCDCRSPEPRWASINLGITLCIECSGVHRSLGVHYSKVRSLTLDAWESENVKVMM 450

  Fly    88 QMGNSRARAVYEAQLPD--GFRRPQTDTAL---ENFIRAKYEHKKYLAREWVPPSPPKVDWAKEI 147
            ::||.....:|||::.|  |.::|.....:   |.:|:|||..::::..   .|.|.:: .|.|.
  Fly   451 ELGNEVVNRIYEARIGDDCGLKKPTEQCEIGVREAWIKAKYVERRFVCG---MPKPQEL-LASET 511

  Fly   148 DEELERQKRKKKSTQAQATLGLAGV-----AGGSG-DKR----LSGSSASALKNTPLPAPLPKPK 202
            .|.|              ::...||     :|||| .||    |.|:...|:|         |.:
  Fly   512 AEVL--------------SIDSGGVVEDGESGGSGIAKRATLSLGGTRKWAVK---------KLR 553

  Fly   203 PNQVGGCSPKTTQRVQLNSSGVSSAGESDLLGLSSPTKPIVATNASQDLQNESFTSFLSAESIAG 267
            ..|.....|||   :..:.|..::|...|.|              ..|..:||..  :.:.|::.
  Fly   554 RRQKQRSIPKT---LSDDPSIYNTAKTGDEL--------------EDDDDDESIN--IPSMSLSI 599

  Fly   268 QPDKPIGSNGDAANLMGSKPNSLAQEEQDFFNQGSLGAGGNEKDQSGKMSKDSILALYGSAPATH 332
            ..|..:....|.|......|..|..:::.  ..|...|...|:....::..:.:|.:   |...|
  Fly   600 SRDDLLVIGDDLALDRLETPGILGSDQES--TDGESDAESPEELPFSQLDANQLLYM---ASVVH 659

  Fly   333 N-PQMNFGGFTGMAPGGYMHQQQQQQIPHQFMTPPNSVSMYNSPVMAAPNAFSN-AAISSATAMS 395
            | |.|......|........|.:|:...||        ::.:..|||......| |||.:...|.
  Fly   660 NLPVMCMAFALGADKMWKNPQDRQRSFLHQ--------AVISGSVMACEFLLLNGAAIDAVDEMG 716

  Fly   396 MGGSH 400
            ....|
  Fly   717 YSALH 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 46/113 (41%)
COG5347 20..300 CDD:227651 82/291 (28%)
CenB1ANP_524458.1 BAR_ACAPs 18..217 CDD:153287
PH 259..352 CDD:278594
PH_ACAP 260..355 CDD:270070
ArfGap 384..497 CDD:279720 46/110 (42%)
ANK 652..768 CDD:238125 20/81 (25%)
Ank_4 683..736 CDD:290365 12/47 (26%)
ANK repeat 687..713 CDD:293786 9/33 (27%)
ANK repeat 715..746 CDD:293786 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464116
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.