DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and adap1l

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_989286.1 Gene:adap1l / 394901 XenbaseID:XB-GENE-5779570 Length:376 Species:Xenopus tropicalis


Alignment Length:105 Identity:51/105 - (48%)
Similarity:69/105 - (65%) Gaps:4/105 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVISLQQMGNS 92
            |.|..|.||.|..|:|||..||:|||:.|:|||||| ..||:|||:.:|.|...||..|...||.
 Frog    19 EGNGTCADCRAPDPQWASPTLGIFLCVDCSGIHRNL-PEISKVKSLIMDNWDDTQVQFLASHGNI 82

  Fly    93 RARAVYEAQLPDGFRRPQ-TDTAL--ENFIRAKYEHKKYL 129
            .|:|:|||.:|..:.||: ||..:  |.:||:|||.|:::
 Frog    83 AAKAIYEAHVPVYYYRPKHTDCHVLREQWIRSKYERKEFI 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 51/105 (49%)
COG5347 20..300 CDD:227651 51/105 (49%)
adap1lNP_989286.1 ArfGap 12..124 CDD:307528 51/105 (49%)
PH1_ADAP 131..239 CDD:270072
PH2_ADAP 253..359 CDD:241282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.