| Sequence 1: | NP_610424.1 | Gene: | CG8243 / 35890 | FlyBaseID: | FBgn0033349 | Length: | 517 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006236000.1 | Gene: | Agap3 / 362300 | RGDID: | 1310751 | Length: | 1093 | Species: | Rattus norvegicus |
| Alignment Length: | 204 | Identity: | 68/204 - (33%) |
|---|---|---|---|
| Similarity: | 103/204 - (50%) | Gaps: | 35/204 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 NAGQRTKLIQEKCQTLLTQMLRDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISR 69
Fly 70 VKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTA---LENFIRAKYEHKKYLAR 131
Fly 132 EWVPPSPPK-VDWAKE-----IDEEL--------ERQKRKKKSTQAQATLGLAGVAGGSGDKRLS 182
Fly 183 GSSASALKN 191 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8243 | NP_610424.1 | ArfGap | 18..132 | CDD:279720 | 52/116 (45%) |
| COG5347 | 20..300 | CDD:227651 | 65/189 (34%) | ||
| Agap3 | XP_006236000.1 | small_GTPase | 309..474 | CDD:197466 | |
| Centaurin_gamma | 311..468 | CDD:133303 | |||
| PH_AGAP | 584..827 | CDD:241281 | |||
| PH | 587..>648 | CDD:278594 | |||
| ArfGap | 855..960 | CDD:279720 | 52/110 (47%) | ||
| Ank_2 | 971..1061 | CDD:289560 | 10/58 (17%) | ||
| ANK | 971..>1060 | CDD:238125 | 10/58 (17%) | ||
| ANK repeat | 971..1001 | CDD:293786 | 3/41 (7%) | ||
| ANK repeat | 1003..1034 | CDD:293786 | 5/14 (36%) | ||
| ANK repeat | 1036..1061 | CDD:293786 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||