DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and CenG1A

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster


Alignment Length:314 Identity:84/314 - (26%)
Similarity:125/314 - (39%) Gaps:97/314 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSSSNAGQRTKLIQEKCQTLLTQML----RDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHR 61
            :.||...|.|       .|.|..||    |...|.:||||.|..|.|||.|||:.:||.|:|:||
  Fly   688 IESSKTKQAT-------STDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHR 745

  Fly    62 NLGVHISRVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTALEN---FIRAKY 123
            |||.|||:|:|:.||.|....:..:..:|||.|.:|:|:...... :|.:..:.|:   ::|:||
  Fly   746 NLGSHISKVRSLGLDDWPSPHLSVMLAIGNSLANSVWESNTRQRV-KPTSQASREDKERWVRSKY 809

  Fly   124 EHKKYL------AREWVPPSPPKVDWAKEIDEELERQKRKK------------------------ 158
            |.|::|      :.....|||     .:::.|.:.|...|.                        
  Fly   810 EAKEFLTPLGNGSSAHPSPSP-----GQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRT 869

  Fly   159 ------------------------KST--QAQATLGLAGVAGGSGDKRLSGSSASALKNTPLPAP 197
                                    |.|  :.:..|..|..|......:...::|:|...|.:|||
  Fly   870 PLLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYARAAQSLATAKSIKAAAAAQAGTTIPAP 934

  Fly   198 LPKPKPNQVGGCSPK-----TTQRVQLNSSGVSSAGESDLLGLSSP-TKPIVAT 245
            .|   |...|..:|:     ||..|:|            |.||..| ..|:.|:
  Fly   935 AP---PTNGGIPAPQYNVEDTTALVEL------------LEGLGCPEAAPLTAS 973

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 49/126 (39%)
COG5347 20..300 CDD:227651 79/295 (27%)
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 47/116 (41%)
ANK <834..907 CDD:238125 6/72 (8%)
ANK repeat 834..866 CDD:293786 3/31 (10%)
Ank_5 859..907 CDD:290568 3/47 (6%)
ANK repeat 868..897 CDD:293786 1/28 (4%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464138
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.