DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and Agap1

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_038939665.1 Gene:Agap1 / 316611 RGDID:1309244 Length:1428 Species:Rattus norvegicus


Alignment Length:133 Identity:56/133 - (42%)
Similarity:80/133 - (60%) Gaps:9/133 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSNAGQRTKLIQEKCQTLLTQMLRD-EDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGV 65
            ||.|..:.|    .:.:.:..|.:|: ..|.:|||||.:.|.|||.|||..:||.|:|||||||.
  Rat  1167 SSKNKSRLT----SQSEAMALQSIRNMRGNSHCVDCDTQNPNWASLNLGALMCIECSGIHRNLGT 1227

  Fly    66 HISRVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTA---LENFIRAKYEHKK 127
            |:|||:|::||.|..|.:..:..:||..|.:|:| :...|..:|..|:.   .|.:||||||.|.
  Rat  1228 HLSRVRSLDLDDWPMELIKVMSSIGNELANSVWE-EGSQGRTKPSLDSTREEKERWIRAKYEQKL 1291

  Fly   128 YLA 130
            :||
  Rat  1292 FLA 1294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 52/117 (44%)
COG5347 20..300 CDD:227651 52/115 (45%)
Agap1XP_038939665.1 Centaurin_gamma 561..722 CDD:133303
PH_AGAP 837..>911 CDD:241281
PH-like <1123..1163 CDD:418428
ArfGap_AGAP2 1180..1288 CDD:350078 47/108 (44%)
ANK repeat 1304..1332 CDD:293786
Ank_2 1307..1397 CDD:403870
ANK repeat 1339..1370 CDD:293786
ANK repeat 1372..1397 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.