DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and Agap2

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_006513621.1 Gene:Agap2 / 216439 MGIID:3580016 Length:1342 Species:Mus musculus


Alignment Length:132 Identity:56/132 - (42%)
Similarity:78/132 - (59%) Gaps:8/132 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SSNAGQRTKLIQEKCQTLLTQMLRD-EDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVH 66
            ||....||   ..:.:.:..|.:|: :.|..||||.|..|.|||.|||..:||.|:|||||||.|
Mouse   912 SSKVKLRT---DSQSEAVAIQAIRNAKGNSTCVDCGAPNPTWASLNLGALICIECSGIHRNLGTH 973

  Fly    67 ISRVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTA---LENFIRAKYEHKKY 128
            :|||:|::||.|..|..:.|..:||..|..|:|:. ..|..:|..|::   .|::||||||...:
Mouse   974 LSRVRSLDLDDWPRELTLVLTAIGNDTANRVWESD-TRGRAKPTRDSSREERESWIRAKYEQLLF 1037

  Fly   129 LA 130
            ||
Mouse  1038 LA 1039

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 52/117 (44%)
COG5347 20..300 CDD:227651 52/115 (45%)
Agap2XP_006513621.1 PHA03247 <52..320 CDD:223021
Centaurin_gamma 401..560 CDD:133303
PH_AGAP 668..908 CDD:241281
ArfGap_AGAP 926..1033 CDD:350065 48/107 (45%)
SelP_N <1136..1188 CDD:368014
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.