| Sequence 1: | NP_610424.1 | Gene: | CG8243 / 35890 | FlyBaseID: | FBgn0033349 | Length: | 517 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006535736.1 | Gene: | Agap3 / 213990 | MGIID: | 2183446 | Length: | 1093 | Species: | Mus musculus |
| Alignment Length: | 205 | Identity: | 70/205 - (34%) |
|---|---|---|---|
| Similarity: | 104/205 - (50%) | Gaps: | 37/205 - (18%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 5 NAGQRTKLIQEKCQTLLTQMLRD-EDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHIS 68
Fly 69 RVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTA---LENFIRAKYEHKKYLA 130
Fly 131 REWVPPSPPK-VDWAKE-----IDEEL--------ERQKRKKKSTQAQATLGLAGVAGGSGDKRL 181
Fly 182 SGSSASALKN 191 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8243 | NP_610424.1 | ArfGap | 18..132 | CDD:279720 | 54/117 (46%) |
| COG5347 | 20..300 | CDD:227651 | 67/190 (35%) | ||
| Agap3 | XP_006535736.1 | Centaurin_gamma | 310..467 | CDD:133303 | |
| PH_AGAP | 583..827 | CDD:241281 | |||
| PRK07003 | <645..>756 | CDD:235906 | |||
| ArfGap_AGAP3 | 843..952 | CDD:350080 | 49/109 (45%) | ||
| Ank_2 | 971..1061 | CDD:372319 | 10/58 (17%) | ||
| ANK repeat | 971..1001 | CDD:293786 | 3/41 (7%) | ||
| ANK repeat | 1003..1034 | CDD:293786 | 5/14 (36%) | ||
| ANK repeat | 1036..1061 | CDD:293786 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||