DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and git-1

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_509761.2 Gene:git-1 / 181253 WormBaseID:WBGene00008805 Length:670 Species:Caenorhabditis elegans


Alignment Length:180 Identity:44/180 - (24%)
Similarity:71/180 - (39%) Gaps:35/180 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LLTQMLRDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVI 84
            |:|.:    :.|.|.||..|...|||...|..:|..|...|..||..:|.::.:....|..|.:.
 Worm     9 LITSL----EQKECDDCGKKEVEWASVKKGTVICSECFCFHSYLGPSVSYLRHLRKSAWDEEHIR 69

  Fly    85 SLQQMGNSRARAVYEAQLPDG---FRRPQTDT---ALENFIRAKYEHKKYLAREWVPPSPPKVDW 143
            .:..:..|....::|:.|.:|   |::|....   ..|.|::.|||...:         .||   
 Worm    70 LVHALNTSNTNMIWESALYEGSTKFQKPMAQDPSHIKEQFVKEKYEKLTF---------QPK--- 122

  Fly   144 AKEIDEELERQKRKK-----KSTQAQATLGLAGVAGG-------SGDKRL 181
             :..||:||....::     :|..|..||.|..:...       :||..|
 Worm   123 -RGKDEDLENSLNRQLIACARSDFAHVTLRLIALGADVNYPDPETGDTAL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 30/117 (26%)
COG5347 20..300 CDD:227651 44/180 (24%)
git-1NP_509761.2 ArfGap 7..127 CDD:214518 32/134 (24%)
ANK <122..212 CDD:238125 13/54 (24%)
Ank_5 152..207 CDD:290568 4/20 (20%)
ANK repeat 165..197 CDD:293786 3/7 (43%)
GIT 264..294 CDD:128828
GIT 326..356 CDD:128828
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.