DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and F07F6.8

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001379858.1 Gene:F07F6.8 / 173926 WormBaseID:WBGene00017220 Length:318 Species:Caenorhabditis elegans


Alignment Length:194 Identity:32/194 - (16%)
Similarity:62/194 - (31%) Gaps:33/194 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 TALENFIRAKYEHKKYLA---------REWVPPSPPKVDWAKEI--DEELERQ-------KRKKK 159
            |.:..|...|.:||:..|         .|.:......::..::|  |||..:.       :.|.|
 Worm   124 TGITKFFHTKGQHKEVAAMIAEDGVLFEELLKSREELMEAVRKIVEDEEFFKHFKNDGDIENKLK 188

  Fly   160 STQAQATLGLAGVAGGSGDKRLSGSSASALKNTPLPAPLPKPKPNQVGGCSPKTTQRVQLNSSGV 224
            :....:..|:.|:........:...|:|.:|.......:       :|......|..:...:.|.
 Worm   189 TVFGGSVTGITGIGTRFAITSMGRLSSSLVKGVLHSVAV-------IGIVLDSVTLALSAKTLGE 246

  Fly   225 SSAGESDLLGLSSPTKPIVATNASQDLQNESFTSFLSAESIAGQPDKPIGSNGDAANLMGSKPN 288
            .|..|   ||.|     |:..::..::..:........|.:....|..:...|....:....||
 Worm   247 GSVSE---LGSS-----ILEASSKMEMMRQKVVKHFLNEDVWKDDDDVLSDVGSIEMVQPESPN 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 6/27 (22%)
COG5347 20..300 CDD:227651 32/194 (16%)
F07F6.8NP_001379858.1 ApoL <59..>126 CDD:398882 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.