Sequence 1: | NP_610424.1 | Gene: | CG8243 / 35890 | FlyBaseID: | FBgn0033349 | Length: | 517 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_114152.3 | Gene: | AGAP3 / 116988 | HGNCID: | 16923 | Length: | 911 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 71/205 - (34%) |
---|---|---|---|
Similarity: | 104/205 - (50%) | Gaps: | 37/205 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 NAGQRTKLIQEKCQTLLTQMLRD-EDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHIS 68
Fly 69 RVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRPQTDTA---LENFIRAKYEHKKYLA 130
Fly 131 REWVPPSPPK-VDWAKE-----IDEEL--------ERQKRKKKSTQAQATLGLAGVAGGSGDKRL 181
Fly 182 SGSSASALKN 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8243 | NP_610424.1 | ArfGap | 18..132 | CDD:279720 | 55/117 (47%) |
COG5347 | 20..300 | CDD:227651 | 68/190 (36%) | ||
AGAP3 | NP_114152.3 | small_GTPase | 126..291 | CDD:197466 | |
Centaurin_gamma | 128..285 | CDD:133303 | |||
PH_AGAP | 401..645 | CDD:241281 | |||
PH | 404..>465 | CDD:278594 | |||
ArfGap | 664..778 | CDD:279720 | 54/119 (45%) | ||
Ank_2 | 789..879 | CDD:289560 | 10/58 (17%) | ||
ANK | 789..>878 | CDD:238125 | 10/58 (17%) | ||
ANK repeat | 789..819 | CDD:293786 | 3/41 (7%) | ||
ANK repeat | 821..852 | CDD:293786 | 5/14 (36%) | ||
ANK repeat | 854..879 | CDD:293786 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |