DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and ACAP3

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_011538908.1 Gene:ACAP3 / 116983 HGNCID:16754 Length:844 Species:Homo sapiens


Alignment Length:536 Identity:124/536 - (23%)
Similarity:183/536 - (34%) Gaps:196/536 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SSSNAGQRTKLIQEKCQTLLTQMLRDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVH 66
            ||.::...|:....|.:::|.::.....|..|.||....|||||.|||:.|||.|:||||:||||
Human   397 SSIDSATDTRERGVKGESVLQRVQSVAGNSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVH 461

  Fly    67 ISRVKSVNLDTWTPEQVISLQQMGNSRARAVYEAQLPD-GFRRPQTDTA---LENFIRAKYEHKK 127
            .|:|:|:.||:|.||.:..:.::|||....:||||... |.|:|...::   .|.:|:.||..||
Human   462 CSKVRSLTLDSWEPELLKLMCELGNSAVNQIYEAQCEGAGSRKPTASSSRQDKEAWIKDKYVEKK 526

  Fly   128 YL-----------AREW------VPPSPPKVDWAKEIDEELERQKRKKKSTQAQATLGLAGV--- 172
            :|           .|.|      .|.|.|:...|:       |:.|.:......|.|...|.   
Human   527 FLRKAPMAPALEAPRRWRVQKCLRPHSSPRAPTAR-------RKVRLEPVLPCVAALSSVGTLDR 584

  Fly   173 -----------------------AGGSGDKRLSGSSASALKNTPLPAPLPKPKPNQVGGCSPKTT 214
                                   |.|:|.:.||..|.                   :||      
Human   585 KFRRDSLFCPDELDSLFSYFDAGAAGAGPRSLSSDSG-------------------LGG------ 624

  Fly   215 QRVQLNSSGVSSAGESDLLGLSSPTKPIVATNASQDLQNESFTSFLSAESIAGQPDKPIGSNGD- 278
                      ||.|.||:|...|.:   |..:.:::...||       |..:|:.|      || 
Human   625 ----------SSDGSSDVLAFGSGS---VVDSVTEEEGAES-------EESSGEAD------GDT 663

  Fly   279 --------------------------------AANLMGSKPNSLAQEEQ---------------- 295
                                            ||...|::.|....|::                
Human   664 EAEAWGLADVRELHPGLLAHRAARARDLPALAAALAHGAEVNWADAEDEGKTPLVQAVLGGSLIV 728

  Fly   296 -DFFNQGSLGAGGNEKDQSGKMSKDSILALYGSAPATHNPQMNFGGFTG-----MAPGGYMHQQQ 354
             :|..|.  ||..|::|..|:            ||..|...:   |.||     :..|...|...
Human   729 CEFLLQN--GADVNQRDSRGR------------APLHHATLL---GRTGQVCLFLKRGADQHALD 776

  Fly   355 QQQIPHQFMTPPNSVSMYNSPVMAAPNAFSNAAISSATAMSMGGSHGFTGAQFPSTGGSPYAAAG 419
            |:|               ..|:..|..| :||.|.:...::............|   |.|.|.||
Human   777 QEQ---------------RDPLAIAVQA-ANADIVTLLRLARMAEEMREAEAAP---GPPGALAG 822

  Fly   420 QAAATNLMQTNQSILS 435
            ........:..|..:|
Human   823 SPTELQFRRCIQEFIS 838

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 50/128 (39%)
COG5347 20..300 CDD:227651 90/376 (24%)
ACAP3XP_011538908.1 BAR 16..225 CDD:299863
PH 279..373 CDD:278594
PH_ACAP 281..377 CDD:270070
ArfGap 413..531 CDD:279720 50/117 (43%)
ANK 711..>798 CDD:238125 23/119 (19%)
ANK repeat 712..743 CDD:293786 5/32 (16%)
Ank_4 715..766 CDD:290365 13/67 (19%)
ANK repeat 745..776 CDD:293786 9/45 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.