DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and ADAP1

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:NP_001271237.1 Gene:ADAP1 / 11033 HGNCID:16486 Length:385 Species:Homo sapiens


Alignment Length:129 Identity:48/129 - (37%)
Similarity:71/129 - (55%) Gaps:25/129 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 YCVD--------------CDAKG-------PRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNL 75
            ||::              |..:|       |.|||:.||:|:|:.|:|||||: ..:|:||||.|
Human    10 YCINPARRKWKEFEKMLGCAEEGHASLGRDPDWASYTLGVFICLSCSGIHRNI-PQVSKVKSVRL 73

  Fly    76 DTWTPEQVISLQQMGNSRARAVYEAQLPDGFRRP-QTDTAL--ENFIRAKYEHKKYLAREWVPP 136
            |.|...||..:...||..|||.:|:::|..:.|| .:|..|  |.:||||||.::::..|...|
Human    74 DAWEEAQVEFMASHGNDAARARFESKVPSFYYRPTPSDCQLLREQWIRAKYERQEFIYPEKQEP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 46/123 (37%)
COG5347 20..300 CDD:227651 48/129 (37%)
ADAP1NP_001271237.1 ArfGap 28..137 CDD:214518 45/109 (41%)
PH1_ADAP 141..249 CDD:270072
PH 142..239 CDD:278594
PH2_ADAP 263..368 CDD:241282
PH 266..366 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.