DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and Arap3

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_006525549.1 Gene:Arap3 / 106952 MGIID:2147274 Length:1539 Species:Mus musculus


Alignment Length:265 Identity:77/265 - (29%)
Similarity:108/265 - (40%) Gaps:32/265 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QTLLTQMLRDED----------NKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKS 72
            |..:|:.|.|.:          |::|.||.|..|.||:.|||:.:|.:|||.||.||..||:|:|
Mouse   475 QEAVTETLSDYEVAEKVWSNPANRHCADCRASRPDWAAVNLGVVICKQCAGQHRALGSGISKVQS 539

  Fly    73 VNLDT--WTPEQVISLQQMGNSRARAVYEAQLP--DGFRRPQTDTALENFIRAKYEHKKYLAREW 133
            :.|||  |:.|.|.....:||.||...:...||  :|............||..||  |..|.|:.
Mouse   540 LKLDTSVWSNEIVQLFIVLGNDRANCFWAGALPPGEGLHPDSAPGPRGEFISRKY--KLGLFRKP 602

  Fly   134 VPPSPPKVDWAKEIDEELERQKRKKKSTQAQATLGLAGVAGGSGDKRLSGSSASALKNTPLPAPL 198
            .|..|......:.:...:......|...|      |..|....|::.||.|:.    |..|.:.|
Mouse   603 HPRHPDHSQLLQALCAAMAGPNLLKNMAQ------LLCVETSEGEEPLSPSAL----NGSLLSLL 657

  Fly   199 PKPKPNQVGGCSPKTTQRVQLNSSGVSS-AGESDL-LGLSSPTKPIVATNASQDLQNESFTSFLS 261
            |...|..........|.|..|....:|: ||...| .|..:|.:......|:.    |.|.|..|
Mouse   658 PSDSPGVYNEVVVPATYRGFLYCGSISNKAGAPPLRRGRDAPPRLWCVLGAAL----EMFASESS 718

  Fly   262 AESIA 266
            .|.::
Mouse   719 PEPLS 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 46/127 (36%)
COG5347 20..300 CDD:227651 76/263 (29%)
Arap3XP_006525549.1 SAM_Arap1,2,3 4..66 CDD:188889
PHA03247 <81..312 CDD:223021
PH1_ARAP 285..377 CDD:270073
PH2_ARAP 392..475 CDD:270074 77/265 (29%)
ArfGap_ARAP3 485..600 CDD:350089 42/116 (36%)
PH-like 671..783 CDD:388408 15/57 (26%)
PH-like 798..891 CDD:388408
RhoGAP_ARAP 906..1081 CDD:239850
Ubiquitin_like_fold 1113..1210 CDD:391949
PH5_ARAP 1210..1326 CDD:270079
PLN02983 <1472..>1538 CDD:215533
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.