DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8243 and adap2

DIOPT Version :9

Sequence 1:NP_610424.1 Gene:CG8243 / 35890 FlyBaseID:FBgn0033349 Length:517 Species:Drosophila melanogaster
Sequence 2:XP_021329475.1 Gene:adap2 / 100331455 ZFINID:ZDB-GENE-070912-21 Length:418 Species:Danio rerio


Alignment Length:150 Identity:55/150 - (36%)
Similarity:81/150 - (54%) Gaps:10/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QEKCQTLLTQMLRDEDNKYCVDCDAKGPRWASWNLGMFLCIRCAGIHRNLGVHISRVKSVNLDTW 78
            :||.:.:|.::::..:|..|.||.|..|.|||..||:|:|:.|:|.||||.. |||:||:.||.|
Zfish     4 REKNKKILLELVKLPENNCCADCGAADPDWASCKLGIFVCLTCSGTHRNLPT-ISRIKSIRLDFW 67

  Fly    79 TPEQVISLQQMGNSRARAVYEAQLPDGFRRP---QTDTALENFIRAKYEHKKYLAREWVPPSPPK 140
            ..|.|..::..||..|:..||..:|..:.||   ..:...|.:||||||..::...:...|....
Zfish    68 DDELVQFMKANGNCSAKNFYEKCVPVFYYRPHPHDCEVLREQWIRAKYERMEFTEEKTERPYTAD 132

  Fly   141 VD----WAKEID--EELERQ 154
            |.    |.|..|  :.|||:
Zfish   133 VYEGMLWKKGRDNGQFLERK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8243NP_610424.1 ArfGap 18..132 CDD:279720 45/116 (39%)
COG5347 20..300 CDD:227651 53/143 (37%)
adap2XP_021329475.1 ArfGap 8..123 CDD:307528 45/115 (39%)
PH1_ADAP 134..240 CDD:270072 6/18 (33%)
PH2_ADAP 254..361 CDD:241282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.