DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30349 and AT1G15420

DIOPT Version :9

Sequence 1:NP_610421.1 Gene:CG30349 / 35885 FlyBaseID:FBgn0050349 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_849671.1 Gene:AT1G15420 / 838113 AraportID:AT1G15420 Length:278 Species:Arabidopsis thaliana


Alignment Length:296 Identity:68/296 - (22%)
Similarity:131/296 - (44%) Gaps:53/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 GEKLNVIVRADPKKLYAKKKGKEQPGYQAATKVQKPIVNQKNVEYNSALPISQKKVQNEVPMEAR 406
            |:..:..:|....|..:||:.:.:|.. .:|:......::..|..:..|        ||..:..:
plant    16 GDIADTPLREKKHKKKSKKRAEPEPDI-PSTRDSGLDEDRDGVLVDDTL--------NEPTIGDK 71

  Fly   407 LEHLKIQGTKLSGGKLLTQSKTQ-----------------LLMQALHSKDQAMIQAVLSTQDPET 454
            ||.|.:    |:|.|:.::...:                 ||.||||:.|::::...|..:|.:.
plant    72 LESLDL----LNGEKVNSEESNRDSAPGDDKPPTAASVNVLLRQALHADDRSLLLDCLYNRDEQV 132

  Fly   455 IQLTLDRLPLDYVNPLVNELSILLQGKHASVRSALRWLHALTSTHTSVLMSEDKEALREKLAVCL 519
            |..::.:|....|..|:|.|..:||.:.|.:...:.|:.:|..||:|.:||::...|  .|....
plant   133 IANSVAKLNSAEVLKLLNALLPILQSRGAILACTIPWIKSLLLTHSSGIMSQESSLL--ALNTMY 195

  Fly   520 GVAEQRMHCLSEALQITGRVNLIINQMKRNADNHLNDNKALILDEDPDEPDPEAETNWSDLEEDQ 584
            .:.|.|:..:..|::::..::||::.:    |...::...:..|:|.||.:.|.      :||  
plant   196 QLIESRVSTIHTAVEVSSGLDLIVDDL----DEEEDEGPVIYEDKDSDEDEEEG------IEE-- 248

  Fly   585 PGSPKSPLEDELVADD--DLATDDGNADADTDSDVS 618
                  .:|.:..|||  |.|.|..| |.:...|:|
plant   249 ------AMETDEEADDSADEAADGVN-DFEGFDDMS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30349NP_610421.1 WD40 <7..237 CDD:225201
WD40 repeat 7..50 CDD:293791
WD40 11..>230 CDD:295369
WD40 repeat 72..108 CDD:293791
WD40 repeat 117..151 CDD:293791
WD40 repeat 159..191 CDD:293791
WD40 repeat 200..241 CDD:293791
WD40 repeat 248..273 CDD:293791
Utp12 439..534 CDD:281932 24/94 (26%)
AT1G15420NP_849671.1 Utp12 116..218 CDD:397900 24/103 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4547
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002889
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR44267
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.