DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30349 and SPCC1450.03

DIOPT Version :9

Sequence 1:NP_610421.1 Gene:CG30349 / 35885 FlyBaseID:FBgn0050349 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_588302.1 Gene:SPCC1450.03 / 2539316 PomBaseID:SPCC1450.03 Length:240 Species:Schizosaccharomyces pombe


Alignment Length:194 Identity:43/194 - (22%)
Similarity:84/194 - (43%) Gaps:38/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   430 LLMQALHSKDQAMIQAVLSTQDPETIQLTLDRLPLDYVNPLVNELSILLQGKHASVRSALRWLHA 494
            ||.|.|:..|..::...:...|        ..:..|....|:..:.|.:|      .|...|||.
pombe    20 LLEQCLNCSDVGVVSNTVRNMD--------GTIAADLARTLIPAMLINMQ------PSLAIWLHW 70

  Fly   495 LTSTH----TSVLMSEDK-EALREKLAVCLGVAEQRMHCLSEALQITGRVNLIINQMKRNADNHL 554
            :..||    |:|:..:|. ..|.|||.       |..|.:::...::|::|::::|         
pombe    71 IIVTHGGYLTTVMDLQDSLVQLHEKLV-------QSAHLMTKIFSLSGKLNMVLSQ--------- 119

  Fly   555 NDNKALILDEDPDEPDPEAETNWSDLEEDQPGSPKSPLEDELVADDDLATD-DGNADADTDSDV 617
            .:.:...||...::.:.|.|.::.|.:.|:.|.....:::  ..:||:..| :.||||..:|::
pombe   120 EEMRQRRLDFSSEDGEEEEENDYIDEDVDEAGYDIEVVDE--AENDDMDNDLEANADAFDESNL 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30349NP_610421.1 WD40 <7..237 CDD:225201
WD40 repeat 7..50 CDD:293791
WD40 11..>230 CDD:295369
WD40 repeat 72..108 CDD:293791
WD40 repeat 117..151 CDD:293791
WD40 repeat 159..191 CDD:293791
WD40 repeat 200..241 CDD:293791
WD40 repeat 248..273 CDD:293791
Utp12 439..534 CDD:281932 21/99 (21%)
SPCC1450.03NP_588302.1 Utp12 18..116 CDD:281932 27/116 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4547
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002889
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.