DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30349 and T10B5.3

DIOPT Version :9

Sequence 1:NP_610421.1 Gene:CG30349 / 35885 FlyBaseID:FBgn0050349 Length:620 Species:Drosophila melanogaster
Sequence 2:NP_503519.2 Gene:T10B5.3 / 178667 WormBaseID:WBGene00020389 Length:295 Species:Caenorhabditis elegans


Alignment Length:304 Identity:72/304 - (23%)
Similarity:129/304 - (42%) Gaps:53/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 AKKKGKEQPGYQAAT------KVQKPIVN---QKNVEYNSALPISQKKVQNEVPMEAR------- 406
            |:::...:....|.|      |::.|:||   ..|....:...:|:.:.:...|:..|       
 Worm     2 ARERKARKSNVAAVTSPATPEKIESPVVNGHSHINGSLRNGKKLSESEKEANKPLGDREKEPATP 66

  Fly   407 LEHLKIQGTKLSGGKLLTQSKTQLLMQALHSKDQAMIQAVLSTQDPETIQLTLDRLPLDYVNPLV 471
            ...||...|..|||    .|:..||.|.:.:.|.|.|.:|:...:.|.|..||..|....|.||:
 Worm    67 TSELKKGKTSGSGG----GSQCVLLTQGIMANDSAKIDSVIRNLNSEIIHATLRDLQPMQVLPLL 127

  Fly   472 NELSILLQGKHAS-VRSALRWLHALTSTHTSVLMSEDKEALREKLAVCLGVAEQRMHCLSEALQI 535
            ..:...|:.::|: :|..:||.....|.|...|.|...  |.:::...:|....|:....:.|.:
 Worm   128 KIIESRLKTRNAADIRPTIRWAQIAFSIHMPYLSSLPN--LEKEIGGLIGWLRSRVGHHRDLLAL 190

  Fly   536 TGRVNLIINQMKRNADNHLNDNKALI-----LDED--------PDEPDPEAETNW---SDLEEDQ 584
            .|:::.|.:.:||..:|.:...:.|:     ||.|        .|:....:|.:|   ::|:||:
 Worm   191 HGKISTIADLIKRRTNNVVIVQQPLVVFNNDLDSDSEDFDTIGSDDDGESSEDDWWEDNELKEDE 255

  Fly   585 PGSPKSPLEDELVADDDLATDDGNADAD--------TDSDVSMD 620
            ..:...  :||    ||..:||...|||        :::|..|:
 Worm   256 EENQDD--DDE----DDNDSDDSEMDADSAESGGSGSENDEDME 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30349NP_610421.1 WD40 <7..237 CDD:225201
WD40 repeat 7..50 CDD:293791
WD40 11..>230 CDD:295369
WD40 repeat 72..108 CDD:293791
WD40 repeat 117..151 CDD:293791
WD40 repeat 159..191 CDD:293791
WD40 repeat 200..241 CDD:293791
WD40 repeat 248..273 CDD:293791
Utp12 439..534 CDD:281932 24/95 (25%)
T10B5.3NP_503519.2 Utp12 94..191 CDD:367767 25/98 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4547
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002889
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102917
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1622
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.