DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8252 and Akap14

DIOPT Version :9

Sequence 1:NP_610420.1 Gene:CG8252 / 35884 FlyBaseID:FBgn0033344 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_067735.1 Gene:Akap14 / 60332 RGDID:708510 Length:502 Species:Rattus norvegicus


Alignment Length:263 Identity:55/263 - (20%)
Similarity:87/263 - (33%) Gaps:70/263 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PPSPGSGVPALGPG-GALPIAIIPSISSLVNQCNKPACDDADMQCIIDLIEGTLCEAVAIIESDP 75
            ||:|.:...::.|. ...|:|::..::..|.|                  :..:.|.....|..|
  Rat   238 PPAPVAPPASVAPPVPDAPVALVAPVAPQVKQ------------------KIRVSEVKRKKEVPP 284

  Fly    76 RGLFIYNFPKKQKMSSI---------SLISSVFTDTIVANG----------EDDPSITNHYTGGL 121
            |      .|:.::|..:         .::|.:...|.|.:|          |..|::.......:
  Rat   285 R------VPQLKEMKVVLFTPEIKEKKVVSEIKEKTQVIDGKEKLIVPDVKEKKPAVVEKKDERM 343

  Fly   122 GISADSVSSGL----------AR------KMLTIGDFEYSNAIADIRDFVSRWELSPDTKCVVIS 170
            ...|.:|..|:          ||      |.||.|:|........|..|||.||.  ..:.|..:
  Rat   344 NEIARTVVEGVLAASVQFVEEARNPIKNIKWLTHGEFTAEKGRKQIEKFVSTWEF--QNRWVYYA 406

  Fly   171 NPIRHEVAKKGTI----LFVDAHFSRPTPRCPNPLAVAKVRFIISLSKILLKHYPVMITYRFEGY 231
            :.|.    ||..|    ......:|.||...|.....|...|.|..:|......||.::|.||..
  Rat   407 DFIE----KKDLIHSFHYIYRVRWSAPTAVRPMARVSANAYFTIKFNKSKPADMPVDVSYIFENS 467

  Fly   232 NTL 234
            ..|
  Rat   468 ELL 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8252NP_610420.1 AKAP28 136..264 CDD:291158 29/103 (28%)
Akap14NP_067735.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..84
8 X 4 AA repeat of P-X-X-P 199..265 6/26 (23%)
RII-binding 258..378 23/143 (16%)
AKAP28 374..494 CDD:291158 29/103 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BW5E
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_109355
Panther 1 1.100 - - LDO PTHR35075
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.