DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8252 and akap14

DIOPT Version :9

Sequence 1:NP_610420.1 Gene:CG8252 / 35884 FlyBaseID:FBgn0033344 Length:292 Species:Drosophila melanogaster
Sequence 2:XP_031746467.1 Gene:akap14 / 100491740 XenbaseID:XB-GENE-994255 Length:190 Species:Xenopus tropicalis


Alignment Length:176 Identity:41/176 - (23%)
Similarity:71/176 - (40%) Gaps:18/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 MSSISLISSVFTDTIVANGEDDPSITNHYTGGLGISADSVSSGLARKMLTI--GDFEYSNAIADI 151
            :::|..|:....:|.:.|.|:      ::....|.........:|:.:..|  .||.....:..|
 Frog    22 IAAIKEIACALVETTIRNVEE------YFQTKHGAPLQEAEKYIAQNITWIPCQDFTIELGMKQI 80

  Fly   152 RDFVSRWELSPD-TKCVVISNPIRHEVAKKGTILFVDAHFSRPTPRCPNPLAVAKVRFIISLSKI 215
            .:::|.||.... ..|....|....|.:|   :......:|.||.|.|.|.|.|.|.|.|.:||:
 Frog    81 EEYISTWEFHESWLHCTDFLNEEEVEFSK---LYHYRTRWSIPTRRKPIPRATACVYFTIQISKV 142

  Fly   216 LLKHYPVMITYRFEGYNTLYYGLGERCLNSFTFQRFYIDTILHTKL 261
            .....||.:.:.||. ..|.:..|:.     .|:..::..|:.:||
 Frog   143 KPLSLPVEVFFIFES-TRLVHRPGQS-----RFREKWLKDIIESKL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8252NP_610420.1 AKAP28 136..264 CDD:291158 34/129 (26%)
akap14XP_031746467.1 AKAP28 65..185 CDD:405201 34/127 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR35075
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.