DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT8 and CCT6A

DIOPT Version :9

Sequence 1:NP_610418.1 Gene:CCT8 / 35882 FlyBaseID:FBgn0284436 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_001753.1 Gene:CCT6A / 908 HGNCID:1620 Length:531 Species:Homo sapiens


Alignment Length:528 Identity:143/528 - (27%)
Similarity:250/528 - (47%) Gaps:40/528 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EEAVFRNISACKEFAQTMRSAYGPNGMNKMIINHIEKQFVTSDAGTIMRELDVEHPAAKLIVMAS 90
            :.|:..||||.:.....:|:..||.|..||:::......:|.|...::.|:.::||.|.||...:
Human    17 QAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLHEMQIQHPTASLIAKVA 81

  Fly    91 QMQDAEVGDGTNFVVVLAGALLESAEELLRLGITTAEISDGYEKALEKALEILPNLVSHKIEDYR 155
            ..||...||||...|::.|.||:.|:..:..|:....|::|:|.|.||||:.|..:   |:....
Human    82 TAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFEAAKEKALQFLEEV---KVSREM 143

  Fly   156 NVEKVKEVLRTSIMSKQYGQ-EDFLNDLVSKACVSILPDEGTFNVDNIRICKILGSGLTKSEVVR 219
            :.|.:.:|.|||:.:|.:.: .|.|.:.|..:.::|...:...::..|.|.::.....|.:.::|
Human   144 DRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIKKQDEPIDLFMIEIMEMKHKSETDTSLIR 208

  Fly   220 GMVF----------KRFVEGDVTYAEKAKIVIFSCPVDIIQTETKGTVLIKSADELLSFSSGEES 274
            |:|.          ||        .|.|.|:..:..::..:||.......|||:|.......|..
Human   209 GLVLDHGARHPDMKKR--------VEDAYILTCNVSLEYEKTEVNSGFFYKSAEEREKLVKAERK 265

  Fly   275 LLESQIKAI----------ADAGVKVVVAGGKVGDMALHFLNKYGLMAVRLNSKFDLRRLSRSVN 329
            .:|.::|.|          :|.|..|:...| :...:|..|:|.|::|:|...:.::.||:.:..
Human   266 FIEDRVKKIIELKRKVCGDSDKGFVVINQKG-IDPFSLDALSKEGIVALRRAKRRNMERLTLACG 329

  Fly   330 ATVLPRITTPSQEELGYCDKVCIEELGDTTIVAFRNEGKDSRIATVVIRGATDNFMDDIERALDD 394
            ...|......|.:.||:...|....||:... .|..:..:.|..|::|:|...:.:..|:.|:.|
Human   330 GVALNSFDDLSPDCLGHAGLVYEYTLGEEKF-TFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRD 393

  Fly   395 AINNFKCLTRDGRYLPGAGATEIELATQLSAYADTLPGLDQYAVRKFANALEVFPKALAENSGIN 459
            .:...|....||..:|||||.|:.:|..|..:..::.|..|..|:.||:||.:.||.||:|||.:
Human   394 GLRAVKNAIDDGCVVPGAGAVEVAMAEALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFD 458

  Fly   460 GTEIVNQLYLAHNNEAGKTIGFDIEAEKASTIDTTKAKLFDLYQSKFWGLKYAVGAAATILKVDQ 524
            ..|.:.::...| :|:|:.:|.|:..  ...:...:..::|.|..|...|......|..||.||:
Human   459 LQETLVKIQAEH-SESGQLVGVDLNT--GEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDE 520

  Fly   525 IIMAKRAG 532
            |:   |||
Human   521 IM---RAG 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT8NP_610418.1 TCP1_theta 20..529 CDD:239457 140/523 (27%)
Cpn60_TCP1 40..529 CDD:278544 135/509 (27%)
CCT6ANP_001753.1 chap_CCT_zeta 3..530 CDD:274088 143/528 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D207515at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.