DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCT8 and AT4G08640

DIOPT Version :9

Sequence 1:NP_610418.1 Gene:CCT8 / 35882 FlyBaseID:FBgn0284436 Length:546 Species:Drosophila melanogaster
Sequence 2:NP_192604.2 Gene:AT4G08640 / 826429 AraportID:AT4G08640 Length:171 Species:Arabidopsis thaliana


Alignment Length:205 Identity:53/205 - (25%)
Similarity:88/205 - (42%) Gaps:45/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 TFNVDNIRICKILGSGLTKSEVVRGMVFKRFVEGDVTYAEKAKIVIFSCPVDIIQTETKGTVLIK 260
            |.|:|::.:.||||....||.||.|:|||....|::.:.                        :|
plant     2 TMNIDDVHVAKILGVDSRKSCVVCGIVFKSDDVGNIRHP------------------------LK 42

  Fly   261 SADELLSFSSGEESLLESQIKAIADAGVKVVVAGGKVGDMALHFLNKYGLMAVRLNSKFDLRRLS 325
            :| ::.:|...:|::||:.:|.||.:.|||:|:...:.:|.|.|...|.:|.::::|..|:..|.
plant    43 NA-KVHNFGKSKEAMLETLVKDIAFSNVKVIVSRSSICEMTLRFCKIYKIMVLQISSDIDINSLC 106

  Fly   326 RSVNATVLPRITTPSQEELGYCDKVCIEELGDTTIVAFRNEGKDSRIATVVIRGATDNFMDDIER 390
            ..|.|....:...|  ..|||.|...:.|:...   |.:...:|:..|               ||
plant   107 SIVGAIDSSQHFQP--HHLGYMDSTSLSEIAKR---AVKKAERDAERA---------------ER 151

  Fly   391 ALDDAINNFK 400
            |.......||
plant   152 ASQKKAEKFK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCT8NP_610418.1 TCP1_theta 20..529 CDD:239457 53/205 (26%)
Cpn60_TCP1 40..529 CDD:278544 53/205 (26%)
AT4G08640NP_192604.2 chaperonin_like <2..>139 CDD:295468 45/166 (27%)
DUF3812 <131..169 CDD:289523 9/49 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0362
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.